Please note that we will be retiring this old site on Tuesday, August 25th, 2015.
At that point, the URL for www.pseudomonas.com will bring you to our new site currently hosted at beta.pseudomonas.com. We encourage you to visit the new site now and see a more recent set of updated gene annotations and MANY more Pseudomonas strains.
Pseudomonas Genome Database - Annotation for PA1276
               gene PA1276                
Add this annotation to your clipboard
Key to gene image


View in GBrowse: (?)
46 putative orthologs Acknowledgements for this annotation
Feature Overview
Strain Pseudomonas aeruginosa PAO1 (Tax ID: 208964) Replicon Pseudomonas aeruginosa PAO1 chromosome, complete genome.
(5688 genes, 6264404 bp) [ RefSeq ]
Feature type gene  Genomic location 1387254 - 1388249 (+ strand)
Name cobC  (View this annotation at our new website) Alternate Names cobD
Locus tag PA1276 (View 7 updates) Submit an Update Tranposon Mutant Available? 1 mutant(s) available.
Product Information
Feature type CDS
Product Name cobalamin biosynthetic protein CobC
Product Name Confidence Class 2: Function of highly similar gene experimentally demonstrated in another organism (and gene context consistent in terms of pathways its involved in, if known).
Alternate Names
Charge at pH 7 (Predicted):3.02
Kyte-Doolittle Hydropathy Score (Predicted):-0.224
Molecular Weight (Predicted):36.7 kDa
Isoelectric Point (Predicted):7.95
Subcellular localization
CompartmentTypeConfidence LevelExplanation of Localization Confidence
Cytoplasmic Primary Class 3: Subcellular localization computationally predicted by PSORTb V3.0.
Orthologs/Comparative Genomics
Pseudomonas Ortholog Group Explanation of Orthologous Groups
Number of Orthologs in Pseudomonas species 46 putative orthologs
OrtholugeDB (New!) Explanation of Orthologous Groups
Secondary Genomic Features contained in PA1276
Name Sequence Start Stop Strand PubMed IDs Cross Reference Other Notes
Inverted repeat (palindrome) of 1388217..1388207
Retrieve 1388123 1388133 + 10827456
Software: Palindrome (Emboss 6.2.0)
Confirmed ISlacZ/hah insertion site
1388175 1388175 + 14617778
UWGC: 8682
Inverted repeat (palindrome) of 1388123..1388133
Retrieve 1388207 1388217 - 10827456
Software: Palindrome (Emboss 6.2.0)
Alternate Annotations and Cross-References
GI 15596473
Precomputed BLAST results NCBI BLINK
RefSeq NP_249967
TIGR NTL03PA01277
UniProtKB Acc Q9I468
UniProtKB ID COBC_PSEAE
Affymetrix PA1276_cobC_at
KEGG PA1276
GBrowse Click GBrowse for a GBrowse View of this and other annotations.
PseudoCyc Click here to view metabolic pathways in PseudoCyc.
Gene Ontology (GO) - Participate in the 2014 Gene Ontology Annotation initiative and get your name on a consortium publication!
GO Accession GO Term Evidence
Code
Reviewed
by curator?
Reference
Molecular Function
GO:0048472 threonine-phosphate decarboxylase activity IEA No
Biological Process
GO:0009236 cobalamin biosynthetic process ISS Yes
Cellular Component
Function Classification
PseudoCAP Function Class Biosynthesis of cofactors, prosthetic groups and carriers
Pathways
Pathways Explanation of Pathways Field
Name Database Xref
Cobalamin biosynthesis PseudoCAP
cobalamin biosynthesis, aerobic pathway PseudoCyc P381-PWY
Porphyrin and chlorophyll metabolism KEGG pae00860 Computationally Generated
Metabolic pathways KEGG pae01100 Computationally Generated
Reactions
EC Number 3.5.1.90
Homology
BLINK Precomputed BLAST results at BLINK
Homologs Explanation of Homologs Field 44% similar to CobD [Salmonella typhimurium]
55% similar to CobC [Pseudomonas denitrificans]
Structure Features
Structure Features Explanation of Structure Features Field PS00105: Aminotransferases class-I pyridoxal-phosphate attachment site
CDD predictions Explanation of CDD predictions
CDD Accession External Accession Database Short Name Description Start Stop E-value Release Number
223157 COG0079 COG HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] 1 304 2e-39 3.10
180188 PRK05664 PRK PRK05664 threonine-phosphate decarboxylase; Reviewed 1 309 8e-126 3.10
233289 TIGR01140 TIGRFAM L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase 4 309 3e-80 3.10
215756 pfam00155 Pfam Aminotran_1_2 Aminotransferase class I and II 20 189 1e-09 3.10
99734 cd00609 CD AAT_like Aspartate aminotransferase family 23 226 6e-17 3.10
 
Microarray Expression Data
NCBI GEO Link
DNA Sequence
Upstream 500 BP Region CCGAGTCGGTACTGGAGAACGGCAGCGACGCGGTCTACGCCGCCCTGTTCTGGTTCGCCGTGGCCGGCGCGCCGGGGGTGGTGCTGTATCGCCTGAGCAA
TACCCTGGACGCGATGTGGGGCTACCGCAACGCGCGCTTCGAGCGCTTCGGCTGGGCCGCGGCGAAGATCGACGACATCCTCAACTACCTGCCGGCGCGG
CTGGTGGCGCTGACCTACGCGCTGCTCGGCGACACCCGCCAGGCCCTGCGCTGCTGGCGCGAGCAGGCGCCGCAATGGGACAGCCCCAACGCCGGCCCGG
TGATGGCCGCCGGCGCCGGTGCGCTGGGGGTTTTCCTGGGCGGCGCGGCGATCTACCACGGCGAGCTGCACCAGCGGCCGCTCCTCGGCAGCGGCCCGCA
GCCGCAGGGCCGCGACATCTATCGGGCTCTGGCGCTGGTGCGCCAGGGCGTGCTGCTCTGGCTGCTGGTGCTGGCCGGACTCTGGGCCATGGGGTGGCTG
C


BLAST search against this genome or other genomes in database
Need more than 500 BP? Try our sequence retrieval tool or view intergenic regions in GBrowse.

DNA Sequence ATGCTTGAACACGGAGGACGGTTGCGCGAGGCGGCGCGCCGTTACGACATTCCGCTGGCGGACTGGCTGGACCTGTCCACCGGCATCGCGCCCTGGCCGT
TTTCGCTGCCGGCGATCCCCGAGCAGGCCTGGACCCGCCTGCCGGAGAGCGACGACGGCCTGGAAGCCGCCGCCTGCCTCTACTACGGCGCCGAACGGGT
ATTGCCGCTGGCTGGCAGCCAGGCGGCGATCCAGGCCCTGCCGAGGATGCGGCGGGGCGGGCGGGTCGGCGTCCTGTCGCCGTGCTACGCCGAGCACGCC
CACGCCTGGCGCCAGGCCGGGCACCTGGTGCGGGAGATCGGCGAGGCCGAGGTCGAGCCCTATCTCGACAGCCTCGACGTGCTGCTGGTGGTCAACCCGA
ACAACCCCACCGGGCGGGTCTTCGAGCCCGCCGAGCTACTGGCCTGGCATGCCCGCCTGCAACGTCGCGGCGGCTGGCTGCTGGTCGACGAGGCGTTCAT
GGACTGCACCCCGCAGTCGAGCCTGGCGGCCTGCAGCAACCGGCCCGGATTGATCGTGCTGCGCTCGTTCGGCAAGTTCTTCGGCCTGGCCGGCGCGCGG
CTCGGCTTCGCCCTCGGCGAACGGCCGCTGTTGCAGGCGCTGGCCGAGCAGCTCGGTCCGTGGACGGTCAATGGCCCGGTGCGCCATGTGGCCCAGAGTG
CCTTGCGCGACCGCCAGCAACAGCGCCAGCAGCGCGAGCGCCTGCTGGCCGCCAGCCAGCGCCTGGAGGAACTGCTGCGCCGCCACGGCTGGCCGCCGGC
GGGCGGCAGCGCGCTGTTCCAGCGCCTGGTCGATCCACGCTGCGCGGCGTTGCACGACTACCTGGCGCGGCGCGGCATCCTCACCCGCCAATTCGAGCAG
CCGGCCAGCCTGCGCCTCGGCCTGCCCGCCGACGAGGCCGCCTGGGCCCGGCTGGATGCCGCGCTGCTCGGCTTCAAGGAGCCTGCTCATGAGTGA


BLAST search against this genome or other genomes in database

Downstream 500 BP region TCGCGGGCGGACCCTGATGGTCCAGGGCACCACCTCGGACGCCGGCAAGAGCACCCTGGTGACCGCGCTGTGCCGCTGGCTGGCCCGGCGCGGCGTCGCG
GTGGTGCCGTTCAAGCCGCAGAACATGGCGCTGAACAGCGCGGTCACCGCCGACGGCGGCGAGATCGGCCGCGCCCAGGCGGTCCAGGCCCAGGCCTGTC
GGCTGGCGCCGCACACCGACATGAACCCGGTGCTGCTCAAGCCGAACACCGACATCGGCGCCCAGGTGATCATCCATGGCCGCGCGGTGACCAGCATGGA
CGCCGCCGCCTACCACGACTACAAGCGCGTGGCGATGGAAGCGGTGCTGGCTTCCCATGGGCGGCTCGCCGCCGCCTACCGGGTGGTGATGGTGGAGGGC
GCCGGCTCGCCGGCGGAGATCAACCTGCGCGCCAACGACATCGCCAACATGGGCTTCGCCGAAGCGGTGGATTGCCCGGTGATCCTGGTCGCCGATATCG
A


Protein Sequence
Protein Sequence MLEHGGRLREAARRYDIPLADWLDLSTGIAPWPFSLPAIPEQAWTRLPESDDGLEAAACLYYGAERVLPLAGSQAAIQALPRMRRGGRVGVLSPCYAEHA
HAWRQAGHLVREIGEAEVEPYLDSLDVLLVVNPNNPTGRVFEPAELLAWHARLQRRGGWLLVDEAFMDCTPQSSLAACSNRPGLIVLRSFGKFFGLAGAR
LGFALGERPLLQALAEQLGPWTVNGPVRHVAQSALRDRQQQRQQRERLLAASQRLEELLRRHGWPPAGGSALFQRLVDPRCAALHDYLARRGILTRQFEQ
PASLRLGLPADEAAWARLDAALLGFKEPAHE


BLAST search against this genome or other genomes in database
Precomputed BLAST results at BLINK
Operons/Regulons
1) PA1271-cobO-cobB-PA1274-cobD-cobC-cobQ-cobP-cobU-PA1280-cobV ( View in GBrowse  )
Genomic Location: From 1381804 to 1392601 bp on + strand
Genes:
PA1271 (PA1271) PA1272 (cobO) PA1273 (cobB) PA1274 (PA1274) PA1275 (cobD) PA1276 (cobC) PA1277 (cobQ) PA1278 (cobP) PA1279 (cobU) PA1280 (PA1280) PA1281 (cobV)
Estimated Length: 10797 bp (From 1381804 to 1392601 bp)
Evidence:
Class 3: Computationally-predicted.
 [PubMed:18988623]
Cross Reference: DOOR (No external cross-reference is available).  
Genomic Context
Genomic context Explanation of Genomic Context Field - Cluster of genes with homology to cobalamin biosynthetic genes of Pseudomonas denitrificans and/or Salmonella typhimurium