Please note that we will be retiring this old site on Tuesday, August 25th, 2015.
At that point, the URL for www.pseudomonas.com will bring you to our new site currently hosted at beta.pseudomonas.com. We encourage you to visit the new site now and see a more recent set of updated gene annotations and MANY more Pseudomonas strains.
Pseudomonas Genome Database - Annotation for PA3157
               gene PA3157                
Add this annotation to your clipboard
Key to gene image


View in GBrowse: (?)
14 putative orthologs Acknowledgements for this annotation
Feature Overview
Strain Pseudomonas aeruginosa PAO1 (Tax ID: 208964) Replicon Pseudomonas aeruginosa PAO1 chromosome, complete genome.
(5688 genes, 6264404 bp) [ RefSeq ]
Feature type gene  Genomic location 3540782 - 3542671 (- strand)
Name   (View this annotation at our new website) Alternate Names wbpC
Locus tag PA3157 (View 8 updates) Submit an Update Tranposon Mutant Available? 1 mutant(s) available.
Product Information
Feature type CDS
Product Name probable acetyltransferase
Product Name Confidence Class 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited sequence similarity to an experimentally studied gene.
Alternate Names
Charge at pH 7 (Predicted):14.85
Kyte-Doolittle Hydropathy Score (Predicted):0.490
Molecular Weight (Predicted):70.0 kDa
Isoelectric Point (Predicted):9.26
Subcellular localization
CompartmentTypeConfidence LevelExplanation of Localization Confidence
Cytoplasmic Membrane Primary Class 3: Subcellular localization computationally predicted by PSORTb V3.0.
Orthologs/Comparative Genomics
Pseudomonas Ortholog Group Explanation of Orthologous Groups
Number of Orthologs in Pseudomonas species 14 putative orthologs
OrtholugeDB (New!) Explanation of Orthologous Groups
Secondary Genomic Features contained in PA3157
Name Sequence Start Stop Strand PubMed IDs Cross Reference Other Notes
ISlacZ/hah insertion site
3541267 3541267 - 14617778
UWGC: 7323
mini-Tn5 lux transposon insertion site (Transcriptional fusion)
3542007 3542007 N/A 15805499
PseudoCAP: PAO1_lux_12_F4
ISphoA/hah insertion site
3542170 3542170 - 14617778
UWGC: 51538
Rho-independent transcription terminator TERM 2320
Retrieve 3542316 3542303 - 17313685
TransTermHP: TERM 2320
Evidence: Computationally-predicted
Note: overlap 3542307
Confidence: 91
Alternate Annotations and Cross-References
GI 15598353
Precomputed BLAST results NCBI BLINK
RefSeq NP_251847
TIGR NTL03PA03157
UniProtKB Acc Q9HZ74
UniProtKB ID Q9HZ74_PSEAE
Affymetrix PA3157_at
KEGG PA3157
GBrowse Click GBrowse for a GBrowse View of this and other annotations.
PseudoCyc Click here to view metabolic pathways in PseudoCyc.
Gene Ontology (GO) - Participate in the 2014 Gene Ontology Annotation initiative and get your name on a consortium publication!
Function Classification
PseudoCAP Function Class Putative enzymes
Cell wall / LPS / capsule
Pathways
Pathways Explanation of Pathways Field
Name Database Xref
Lipopolysaccharide biosynthesis PseudoCAP
Homology
BLINK Precomputed BLAST results at BLINK
Homologs Explanation of Homologs Field 49% similar to O-antigen acetylase [Salmonella typhimurium]
Structure Features
Structure Features Explanation of Structure Features Field 10 predicted transmembrane domains
9 predicted transmembrane helices (TMHMM v.2.0)
At least one transmembrane helix predicted by Phobius
CDD predictions Explanation of CDD predictions
CDD Accession External Accession Database Short Name Description Start Stop E-value Release Number
224748 COG1835 COG COG1835 Predicted acyltransferases [Lipid metabolism] 9 373 4e-49 3.10
216682 pfam01757 Pfam Acyl_transf_3 Acyltransferase family 40 339 5e-13 3.10
 
Microarray Expression Data
NCBI GEO Link
DNA Sequence
Upstream 500 BP Region AGATCCACGTAAGTCGTTCGGCGTGGCTACCAACATCGGTGTGCACTTCTACGACATGCTGCACTTCATCTTTGGCAAGCTGCAGCGTAATGTTGTGCAC
TTCACTTCCGAGTACAAGGCAGCTGGTTATCTGGAGTACGAGCAGGCCCGTGTGCGTTGGTTTCTGTCCGTGGATGCTAACGACCTGCCGGAGTCGGTCA
AGGGCAAAAAGCCGACCTATCGTTCGATTACCGTCAACGGTGAGGAAATGGAGTTCTCTGAAGGCTTTACCGATCTACATACAACCAGCTACGAAGAAAT
TCTCGCTGGTCGTGGTTATGGCATCGATGACGCTCGTCATTGTGTGGAAACTGTCAATACCATTCGCAGCGCCGTCATCGTACCGGCCTCTGATAACGAA
GGGCATCCGTTCGTCGCGGCGCTTGCGCGTTGAGGTAGAAAAGGAGGTGGCCGTCCTCGGTCACCTGTTTACAGCAGGTTTCCGCAGGATCATTCATCAG
C


BLAST search against this genome or other genomes in database
Need more than 500 BP? Try our sequence retrieval tool or view intergenic regions in GBrowse.

DNA Sequence ATGTCATCTAGTAGCTCTAAATTGCTGAACGGTATGGTCGCGGTAAGTTCAGGCAGAAACATTCGGCTGGATGTCCAGGGGCTGCGGGCTGTTGCAGTTC
TGGCTGTGCTAGCTTACCACGCCAACAGTGCCTGGCTCAGGGCTGGGTTTGTCGGCGTTGACGTGTTCTTCGTCATTTCCGGGTTTATCATTACCGCCTT
ACTGGTCGAGCGCGGTGTAAAAGTTGATCTGGTAGAGTTTTACGCGGGCCGTATCAAACGTATTTTTCCAGCCTATTTCGTCATGTTGGCGATTGTCTGC
ATTGTCTCGACAATTCTGTTTCTGCCTGATGACTATGTTTTTTTTGAAAAAAGTCTACAGTCATCTGTATTTTTTTCCAGTAATCACTATTTCGCTAATT
TTGGTAGTTACTTTGCTCCGAGAGCTGAAGAGCTGCCGCTGCTGCATACTTGGTCGTTGGCCATCGAGATGCAGTTTTATCTGTTCTACCCTGTACTGTT
CATGTGCCTGCCATGTCGATGGCGCTTGCCGGTGTTCATCCTATTAGCTATTTTGCTGTTCATTTGGAGTGGCTATTGCGTATTCAGCGGCAGCCAAGAT
GCTCAGTACTTCGCCTTGCTAGCTCGTGTACCTGAGTTCATGTCGGGAGCTGTTGTCGCATTATCATTACGTGATCGTGAGCTACCCGCCAGGCTTGCGA
TACTTGCGGGGTTATTGGGGGCGGCGTTGCTGGTCTGCTCCTTCATTATCATCGACAAGCAGCACTTTCCCGGATTCTGGTCGCTCCTGCCATGCCTGGG
AGCCGCTCTGCTCATTGCTGCCCGACGTGGCCCTGCCAGCCTGCTGCTGGCCAGCAGGCCCATGGTCTGGATAGGTGGTATCTCCTATTCGTTGTATCTG
TGGCACTGGCCAATTCTGGCATTCATCCGTTACTACACCGGCCAATACGAATTGAGCTTCGTGGCGCTGTTGGCATTTCTCACAGGTTCGTTCCTGCTGG
CCTGGTTCTCATACCGCTACATCGAGACACCTGCCAGAAAGGCTGTGGGTCTGCGCCAGCAGGCGCTGAAGTGGATGTTGGCCGCCAGTGTGGTAGCTAT
AGTGGTTACGGGGGGGGCGCAGTTCAATGTGTTGGTTGTGGCGCCGGCGCCAATTCAGTTGACGCGCTACGCTGTACCAGAGTCGATCTGCCATGGTGTT
CAGGTAGGGGAGTGCAAGCGAGGCAGCGTCAATGCCGTACCCCGTGTGCTGGTGATCGGTGATAGCCATGCTGCGCAGCTTAACTACTTCTTCGACGTGG
TTGGCAACGAGTCAGGTGTGGCTTACCGAGTACTCACCGGAAGCAGTTGTGTGCCTATACCTGCTTTCGATCTTGAACGTTTGCCCCGTTGGGCGCGGAA
ACCCTGCCAAGCGCAGATTGATGCAGTTGCCCAATCAATGTTGAACTTTGACAAGATCATTGTGGCGGGCATGTGGCAGTATCAGATGCAGAGTCCGGCA
TTTGCCCAGGCTATGCGTGCCTTCCTTGTCGATACCAGCTATGCCGGCAAGCAGGTCGTTCTACTCGGGCAGATACCGATGTTCGAATCAAACGTGCAGC
GTGTGCGTCGTTTCAGGGAGCTGGGTTTGTCAGCTCCGCTTGTTAGCTCCAGCTGGCAAGGTGCGAACCAGCTGTTGCGTGCTCTAGCCGAGGGTATTCC
AAACGTACGGTTCATGGATTTTTCTACCAGCGCCTTCTTCGCCGATGCTCCTTATCAGGACGGAGAGCTTATTTACCAGGATAGCCATCACCTTAACGAG
GTGGGGGCTCGCCGCTATGGATATTTCGCGAGCCGTCAATTGCAGCGGCTGTTTGAACAACCACAATCGAGTGTGAGTCTCAAGCCATGA


BLAST search against this genome or other genomes in database

Downstream 500 BP region GTTATTATCAGCACCCCAGCGCGATCGTCGACGACGGTGCGCAGATCGGTAGCGACTCCCGAGTTTGGCACTTCGTGCACATCTGTGCAGGTGCCCGGAT
TGGCGCAGGGGTTTCGTTGGGTCAGAACGTATTCGTCGGCAACAAGGTCGTTATTGGTGATCGCTGCAAGATCCAGAACAACGTGTCGGTATATGACAAT
GTCACTCTCGAAGAGGGCGTGTTCTGCGGGCCGAGCATGGTATTTACCAACGTTTACAACCCCCGCTCGTTGATCGAGCGCAAGGATCAGTACCGTAACA
CGTTGGTAAAAAAAGGTGCCACGCTTGGTGCCAACTGCACTATCGTCTGTGGCGTGACTATTGGTGAATATGCCTTCGTGGGTGCGGGTGCGGTCATTAA
CAAGAATGTTCCATCTTATGCCCTGATGGTAGGCGTGCCCGCTCGACAGATTGGTTGGATGAGCGAATTCGGTGAGCAGCTGCAGCTGAACGAGCAGGGC
G


Protein Sequence
Protein Sequence MSSSSSKLLNGMVAVSSGRNIRLDVQGLRAVAVLAVLAYHANSAWLRAGFVGVDVFFVISGFIITALLVERGVKVDLVEFYAGRIKRIFPAYFVMLAIVC
IVSTILFLPDDYVFFEKSLQSSVFFSSNHYFANFGSYFAPRAEELPLLHTWSLAIEMQFYLFYPVLFMCLPCRWRLPVFILLAILLFIWSGYCVFSGSQD
AQYFALLARVPEFMSGAVVALSLRDRELPARLAILAGLLGAALLVCSFIIIDKQHFPGFWSLLPCLGAALLIAARRGPASLLLASRPMVWIGGISYSLYL
WHWPILAFIRYYTGQYELSFVALLAFLTGSFLLAWFSYRYIETPARKAVGLRQQALKWMLAASVVAIVVTGGAQFNVLVVAPAPIQLTRYAVPESICHGV
QVGECKRGSVNAVPRVLVIGDSHAAQLNYFFDVVGNESGVAYRVLTGSSCVPIPAFDLERLPRWARKPCQAQIDAVAQSMLNFDKIIVAGMWQYQMQSPA
FAQAMRAFLVDTSYAGKQVVLLGQIPMFESNVQRVRRFRELGLSAPLVSSSWQGANQLLRALAEGIPNVRFMDFSTSAFFADAPYQDGELIYQDSHHLNE
VGARRYGYFASRQLQRLFEQPQSSVSLKP


BLAST search against this genome or other genomes in database
Precomputed BLAST results at BLINK
Operons/Regulons
1) wbpB-PA3157-wbpD-wbpE-wzy-wzx-hisH2-hisF2 ( View in GBrowse  )
Genomic Location: From 3535216 to 3543690 bp on - strand
Genes:
PA3151 (hisF2) PA3152 (hisH2) PA3153 (wzx) PA3154 (wzy) PA3155 (wbpE) PA3156 (wbpD) PA3157 (PA3157) PA3158 (wbpB)
Estimated Length: 8474 bp (From 3535216 to 3543690 bp)
Evidence:
Class 3: Computationally-predicted.
 [PubMed:18988623]
Cross Reference: DOOR (No external cross-reference is available).  
Gene has been identified as a virulence factor
Reference Details
VFDB 2008 release: an enhanced web-based resource for comparative pathogenomics.
Yang J, Chen L, Sun L, Yu J, Jin Q.
Nucleic Acids Res. 2008 Jan;36(Database issue):D539-42.
PMID: 17984080
 
Role: Adherence,  Role: LPS O-antigen (P. aeruginosa), 
References
PubMed Genome-wide identification of Pseudomonas aeruginosa exported proteins using a consensus computational strategy combined with a laboratory-based PhoA fusion screen.
Lewenza S, Gardy JL, Brinkman FS, Hancock RE.
Genome Res. 2005 Feb;15(2):321-9.
PMID: 15687295
Molecular characterization of the oafA locus responsible for acetylation of Salmonella typhimurium O-antigen: oafA is a member of a family of integral membrane trans-acylases.
Slauch JM, Lee AA, Mahan MJ, Mekalanos JJ.
J Bacteriol. 1996 Oct;178(20):5904-9.
PMID: 8830685
Molecular characterization of the Pseudomonas aeruginosa serotype O5 (PAO1) B-band lipopolysaccharide gene cluster.
Burrows LL, Charter DF, Lam JS.
Mol Microbiol. 1996 Nov;22(3):481-95.
PMID: 8939432