Please note that we will be retiring this old site on Tuesday, August 25th, 2015.
At that point, the URL for www.pseudomonas.com will bring you to our new site currently hosted at beta.pseudomonas.com. We encourage you to visit the new site now and see a more recent set of updated gene annotations and MANY more Pseudomonas strains.
Pseudomonas Genome Database - Annotation for PA0210
               gene PA0210                
Add this annotation to your clipboard
Key to gene image


View in GBrowse: (?)
39 putative orthologs Acknowledgements for this annotation
Feature Overview
Strain Pseudomonas aeruginosa PAO1 (Tax ID: 208964) Replicon Pseudomonas aeruginosa PAO1 chromosome, complete genome.
(5688 genes, 6264404 bp) [ RefSeq ]
Feature type gene  Genomic location 239779 - 240078 (+ strand)
Name mdcC  (View this annotation at our new website) Alternate Names
Locus tag PA0210 (View 4 updates) Submit an Update Tranposon Mutant Available? 1 mutant(s) available.
Product Information
Feature type CDS
Product Name malonate decarboxylase delta subunit
Product Name Confidence Class 2: Function of highly similar gene experimentally demonstrated in another organism (and gene context consistent in terms of pathways its involved in, if known).
Alternate Names
Charge at pH 7 (Predicted):-2.56
Kyte-Doolittle Hydropathy Score (Predicted):0.203
Molecular Weight (Predicted):10.2 kDa
Isoelectric Point (Predicted):4.99
Subcellular localization
CompartmentTypeConfidence LevelExplanation of Localization Confidence
Cytoplasmic Primary Class 3: Subcellular localization computationally predicted by PSORTb V3.0.
Orthologs/Comparative Genomics
Pseudomonas Ortholog Group Explanation of Orthologous Groups
Number of Orthologs in Pseudomonas species 39 putative orthologs
OrtholugeDB (New!) Explanation of Orthologous Groups
Secondary Genomic Features contained in PA0210
Name Sequence Start Stop Strand PubMed IDs Cross Reference Other Notes
Confirmed ISlacZ/hah insertion site
239825 239825 - 14617778
UWGC: 9096
Alternate Annotations and Cross-References
GI 15595407
Precomputed BLAST results NCBI BLINK
RefSeq NP_248901
TIGR NTL03PA00211
UniProtKB Acc Q9I6S8
UniProtKB ID MDCC_PSEAE
DNASU PaCD00006097
Affymetrix PA0210_mdcC_at
KEGG PA0210
GBrowse Click GBrowse for a GBrowse View of this and other annotations.
PseudoCyc Click here to view metabolic pathways in PseudoCyc.
Gene Ontology (GO) - Participate in the 2014 Gene Ontology Annotation initiative and get your name on a consortium publication!
GO Accession GO Term Evidence
Code
Reviewed
by curator?
Reference
Molecular Function
GO:0000036 ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process RCA No
GO:0016831 carboxy-lyase activity RCA No
Biological Process
GO:0015976 carbon utilization ISS No
GO:0044248 cellular catabolic process ISS No
Cellular Component
Function Classification
PseudoCAP Function Class Carbon compound catabolism
Homology
BLINK Precomputed BLAST results at BLINK
Homologs Explanation of Homologs Field 65% similar to malonate decarboxylase delta subunit MdcC [Klebsiella pneumoniae]
Structure Features
CDD predictions Explanation of CDD predictions
CDD Accession External Accession Database Short Name Description Start Stop E-value Release Number
179253 PRK01220 PRK PRK01220 malonate decarboxylase subunit delta; Provisional 1 99 9e-40 3.10
188283 TIGR03130 TIGRFAM malonate_delta malonate decarboxylase acyl carrier protein 2 96 3e-29 3.10
148461 pfam06857 Pfam ACP Malonate decarboxylase delta subunit (MdcD) 22 98 2e-23 3.10
 
Microarray Expression Data
NCBI GEO Link
DNA Sequence
Upstream 500 BP Region GCCGCACGCAGGCCGGCGAAGTGGCCGCGCGCGCAGGACGCATCGCCCTGCTCGACGATCCGGCGGCCGCCATCGGCGACAGCCACGGCGAGCGCGTCCG
TCGGCGCTACGGCGTCGGCGGCGCCCGCGAGGAGGCGCGTCTCTGCTTCCCCCGCGCAGTGCGCCACGGCCTGCCGCAGCTATGGCGCAGCCGCGAAGGC
GGCGCTGGCGAGCAGAACGCCAGGCTCGATGCGCTGCTGGCGATCATGAGCGTCCTCGACGATACCTGCGTGCTGCACCGCGCCGGCCGCGTCGGCCTCG
CCGCGATGCAGGATGGCGCCCGCGCGGTGCTCGCCGCCGGCGGCAGCGCCAGTCTCGCCGGGCGTCGCCGCCTGTGCGAGCTGGACCGCCGCCTGCTGGC
GCTGAACGCTTCGCCCGGCGGCGCCGCCGACCTGCTGGCCGCCTGTCTTTTCCTCGATCGCCTGCCCGCCGTGTCCGGTGGGTGGGCTGGGAGTCTCTGA
G


BLAST search against this genome or other genomes in database
Need more than 500 BP? Try our sequence retrieval tool or view intergenic regions in GBrowse.

DNA Sequence ATGGAAACCCTGACCTTCGAATTTCCCGCCGGCGCTCCGGCGCGCGGTCGCGCCCTGGCCGGCTGTGTCGGCTCCGGCGACCTGGAGGTGCTGCTCGAGC
CGGCCGCCGGAGGCGCGCTGAGCATCCAGGTGGTGACCTCGGTAAACGGCAGCGGCCCGCGCTGGCAACAACTCTTCGCGCGGGTCTTCGCGGCGTCCAC
GGCGCCGGCCGCGTCGATCCGCATCCACGATTTCGGCGCCACTCCCGGGGTGGTCCGCCTGCGCCTGGAGCAGGCACTGGAGGAGGCTGGCCATGACTGA


BLAST search against this genome or other genomes in database

Downstream 500 BP region CGTCGCCCGCCTGCTGGCGCTGCGCAGCTTCACCGAACTGGGAGCGCGCCAACGCGCCCGTGCCCTGCTTGACGCGGGCAGCTTCCGCGAGTTGCTCGAT
CCCTTCGCCGGCGTGCAGTCGCCCTGGCTGGAACGACAGGGCATCGTGCCCCAGGCCGACGATGGGGTAGTGGTCGCCCGTGGCCTCCTCGACGGCCAGC
CGGCGGTGCTCGCCGCCATCGAAGGTGCTTTCCAGGGCGGCAGCCTTGGCGAAGTCAGCGGAGCGAAGATCGCCGGCGCGCTGGAGCTGGCCGCCGAGGA
CAATCGCAACGGCGTTCCGACCCGGGCCCTGCTGTTGCTGGAAACCGGTGGCGTGCGCCTGCAGGAAGCCAACCTCGGACTGGCGGCGATCGCCGAGATC
CAGGCGGCCATCGTCGATCTGCAGCGCTACCAGCCGGTGGTGGCGGTGATTGCCGGGCCGGTCGGCTGCTTCGGCGGCATGTCCATCGCCGCCGGGCTGT
G


Protein Sequence
Protein Sequence METLTFEFPAGAPARGRALAGCVGSGDLEVLLEPAAGGALSIQVVTSVNGSGPRWQQLFARVFAASTAPAASIRIHDFGATPGVVRLRLEQALEEAGHD

BLAST search against this genome or other genomes in database
Precomputed BLAST results at BLINK
Operons/Regulons
1) mdcA-PA0209-mdcC-mdcD-mdcE-PA0213-PA0214 ( View in GBrowse  )
Genomic Location: From 237232 to 243374 bp on + strand
Genes:
PA0208 (mdcA) PA0209 (PA0209) PA0210 (mdcC) PA0211 (mdcD) PA0212 (mdcE) PA0213 (PA0213) PA0214 (PA0214)
Estimated Length: 6142 bp (From 237232 to 243374 bp)
Evidence:
Class 3: Computationally-predicted.
 [PubMed:18988623]
Cross Reference: DOOR (No external cross-reference is available).  
References
PubMed Sequence of a gene cluster from Klebsiella pneumoniae encoding malonate decarboxylase and expression of the enzyme in Escherichia coli.
Hoenke S, Schmid M, Dimroth P.
Eur J Biochem. 1997 Jun 1;246(2):530-8.
PMID: 9208947