Please note that we will be retiring this old site on Tuesday, August 25th, 2015.
At that point, the URL for www.pseudomonas.com will bring you to our new site currently hosted at beta.pseudomonas.com. We encourage you to visit the new site now and see a more recent set of updated gene annotations and MANY more Pseudomonas strains.
Pseudomonas Genome Database - Annotation for PA0285
               gene PA0285                
Add this annotation to your clipboard
Key to gene image


View in GBrowse: (?)
60 putative orthologs Acknowledgements for this annotation
Feature Overview
Strain Pseudomonas aeruginosa PAO1 (Tax ID: 208964) Replicon Pseudomonas aeruginosa PAO1 chromosome, complete genome.
(5688 genes, 6264404 bp) [ RefSeq ]
Feature type gene  Genomic location 318312 - 320594 (- strand)
Name   (View this annotation at our new website) Alternate Names
Locus tag PA0285 (View 8 updates) Submit an Update Tranposon Mutant Available? 1 mutant(s) available.
Product Information
Feature type CDS
Product Name conserved hypothetical protein
Product Name Confidence Class 4: Homologs of previously reported genes of unknown function, or no similarity to any previously reported sequences.
Alternate Names
Charge at pH 7 (Predicted):-12.43
Kyte-Doolittle Hydropathy Score (Predicted):-0.275
Molecular Weight (Predicted):86.4 kDa
Isoelectric Point (Predicted):6.31
Subcellular localization
CompartmentTypeConfidence LevelExplanation of Localization Confidence
Cytoplasmic Membrane Primary Class 3: Subcellular localization computationally predicted by PSORTb V3.0.
Orthologs/Comparative Genomics
Pseudomonas Ortholog Group Explanation of Orthologous Groups
POG000282 
Orthology uncertain because more than one top BLASTp hit was identified.
Number of Orthologs in Pseudomonas species 60 putative orthologs
OrtholugeDB (New!) Explanation of Orthologous Groups
Secondary Genomic Features contained in PA0285
Name Sequence Start Stop Strand PubMed IDs Cross Reference Other Notes
Inverted repeat (palindrome) of 318900..318891
Retrieve 318833 318842 + 10827456
Software: Palindrome (Emboss 6.2.0)
Confirmed ISlacZ/hah insertion site
318879 318879 + 14617778
UWGC: 17109
Inverted repeat (palindrome) of 318833..318842
Retrieve 318891 318900 - 10827456
Software: Palindrome (Emboss 6.2.0)
ISphoA/hah insertion site
319639 319639 + 14617778
UWGC: 35416
Inverted repeat (palindrome) of 320044..320035
Retrieve 319996 320005 + 10827456
Software: Palindrome (Emboss 6.2.0)
Inverted repeat (palindrome) of 319996..320005
Retrieve 320035 320044 - 10827456
Software: Palindrome (Emboss 6.2.0)
Alternate Annotations and Cross-References
GI 15595482
Precomputed BLAST results NCBI BLINK
RefSeq NP_248976
TIGR NTL03PA00286
UniProtKB Acc Q9I6K5
UniProtKB ID Q9I6K5_PSEAE
Affymetrix PA0285_at
KEGG PA0285
GBrowse Click GBrowse for a GBrowse View of this and other annotations.
PseudoCyc Click here to view metabolic pathways in PseudoCyc.
Gene Ontology (GO) - Participate in the 2014 Gene Ontology Annotation initiative and get your name on a consortium publication!
GO Accession GO Term Evidence
Code
Reviewed
by curator?
Reference
Molecular Function
GO:0009975 cyclase activity IEA No
Biological Process
Cellular Component
Function Classification
PseudoCAP Function Class Membrane proteins
Homology
BLINK Precomputed BLAST results at BLINK
Homologs Explanation of Homologs Field C-terminal 500 amino acids are 59% similar to a region of putative nitrogen fixation positive activator protein [Synechocystis sp.]
Most Similar Human Homolog
ENSP00000345646, Percent Identity: 31.86%, E-Value: 1e-08, Ensembl Release: 73.
Description: High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B (HSPDE8B)(EC 3.1.4.17) [Source:UniProtKB/Swiss-Prot;Acc:O95263]
Structure Features
Structure Features Explanation of Structure Features Field PF00989: PAS domain
PSORT predicted signal peptide and 1 predicted transmembrane domain
PF00785: Motif C-terminal to PAS motifs
PF00563: EAL domain (characteristic of phosphodiesterases)
2 predicted transmembrane helices (TMHMM v.2.0)
At least one transmembrane helix predicted by Phobius
PF00990: GGDEF domain characteristic of diguanylate cyclases
CDD predictions Explanation of CDD predictions
CDD Accession External Accession Database Short Name Description Start Stop E-value Release Number
236645 PRK10060 PRK PRK10060 RNase II stability modulator; Provisional 316 748 1e-99 3.10
227334 COG5001 COG COG5001 Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms] 321 749 2e-98 3.10
232895 TIGR00254 TIGRFAM GGDEF diguanylate cyclase (GGDEF) domain 330 488 6e-32 3.10
215995 pfam00563 Pfam EAL EAL domain 506 742 3e-58 3.10
214491 smart00052 SMART EAL Putative diguanylate phosphodiesterase 506 747 5e-82 3.10
238923 cd01948 CD EAL EAL domain 507 747 4e-87 3.10
 
Microarray Expression Data
NCBI GEO Link
DNA Sequence
Upstream 500 BP Region CTGGTTCTTCGCCTCGGCCTTGTACAGCTCCGCGCCTGCGCGCAGGACGGTGAACAGGCCCTTGTGCACCGGGCTGTGCGGATCCTCGACGGTCTCGCAC
TTGGCATGGTGCTTACGGTGGATAGCGGTCCATTCGCGCGTGTTCATCCCTGTGGTCAACCACAACCAGAAACGGAAGAAGTGCTGCAGCGCGGGGTGCA
GGTCGAGTGCACGGTGGGCGGAATAGCGATGCAGGTAGACGGTCACGCTGACGATGGTGATATGCGTCAGCACCAGGGTAACTGCCACCAGTTGCCACGG
CGACAGGTCGAGAAAACCGTTGAACCACATAGGCGGTACTGAACCTCGGGGGGACTTGGGAGTGATGAGGGCCTTGTCTGACAAAACCTGGGGGCATTAT
CACCAAGCGGCTGGGGATTACCATCCGTTCTTTTAGATATGAACAGGGCCGGATGGCCATCATTTATACTGCCCGGCCAATAATTGCCCACTGAAAATCC
C


BLAST search against this genome or other genomes in database
Need more than 500 BP? Try our sequence retrieval tool or view intergenic regions in GBrowse.

DNA Sequence ATGAGCCCCCGCCTGAGTGCCCTTCGCCTGAGCCTGGCTTATCTCGCAATCGCCATCGCCTGGGCGTTCCTGAGCGATCATTTGTTACAAAACCAGGTCC
AGGACCACGACCAACTGGTGTTCTGGATGACCGCCAAGCGGCTGTTCTTCTTCGCCGCAACCGGCCTGCTCCTGTACCTCTACCTGGTACGCCAGTTCCG
CCGCAAGGCCCAGGCCTACGACGAACTGCACGGCAGCGAGCAGCGCCTGAACCGCGCCCTGGAAGCGGTGCGCGACGGACTCTGGGACTGGGACCTGGTG
ACCGACCGGATGTTCGTCTCGCCGGGCTACGCCGCGCTGATCGGCCTCGCTCCGGAGGAACTCGGCGACCCCATCGAGACCTGGAAGAAGCGCCTGCACC
CGGAAGAGTACGCCACCGTGCTGGAGGCCCACCGCAACCACCTGCAGGGCCTGACCGACAATCTCGACCACATCTACCGCCTGCGCCACAAGGACGGCGA
CTACCGCTGGATCCACTCGCGCGGCCGGGTCCTCCGCGACGCCCTGGGCAAGCCGCTGCACTACACCGGCGTGGCCCGCGACATCACCCTGCAGCGGCTC
AAGGAAGACCACCTGCGCCAGGCCGCGGCGGTATTCGACAGCACCCGCGAGGGCGTTCTGGTCACCGATGCCCAGGCGGTGATCGTGCACGTCAACCCTT
CCTTCGAGCGCATCACCGGCTACCGTTCCGAGGACGTGCTCGGCAAGACCCCGGCGATCCTCCGCTCCGGCCGCCAGGACCAGGCGTTCTACCAGCGCCT
GTGGCTGGCCCTGCGCGAGCAGGACGTCTGGAGCGGAGAGATCTGGAACCGTCGCAAGAGCGGCGAGATCTACCCGCAGTGGCTGCACATCCGCGCGGTG
CGCAACGACCAGGGCCAACTGACCCACTACGTCGGGGTGTTCTCCGACCTGAGCAGCATCAAGCGCTCGGAGAACGAACTGGACTTCCTCGCCCACCACG
ACTCGCTGACCGGCCTGCCCAACCGCGTGCTGCTGCGCGAGCGCATCGAGCAGGCGCTGGAGAACGGCAAGGACCGGACGGTGGCCGGGGCCCTGCTGCT
GATCGACCTCGACCACTTCAAGCACATCAACGACAGCCTCGGCCACACCACCGGCGACATGCTCCTCAAGGAAGTCAGCAAGCGCCTGCAACACCAGCTC
GACGAGCGCTGCCTGCTGTCGCGACTGGGCGGCGACGAATTCGCCATCCTCGTCGAGAACGACGACCCGGAAGCCGTCGCGCGACTCTCACAGCGCATCC
TCGACGGTTTCAACGCGCCGTTCGACATCCACTGCCAGCCGATCTATATCAGCGCCAGCCTCGGTGTCAGCCTCTACCCGGAAGACGCCAGCGACGTCGA
CCACCTGATGCAGCATGCCGACGCCGCGCTGTTCCAGGCCAAGGACAGCGGGCGTAACGCCTACGCCTTCTACACCCGCGTGCTGACCGCCCGGGCCCGC
GCCCATGTCCAGGTGGAGTCGGCCCTGCGCCATGCGCTGGAGCACGACGAACTGCGCGTCCACTACCAGCCGGTGCACGACCTGGCCAGCGGGCGGATCG
TCGGCGTCGAGTCGCTGGTGCGCTGGCAGCATCCCGAGCGCGGCCTGGTGCCGCCAGGCGAGTTCGTCCCGGTGGCGGAGGAATGCGGGCTGATCGCCGC
GCTGGACAATTGGGTGCTCAAGCGTGCCTGCCGGCAGATGCGCGAGTGGCAACAGCGCGGCGTCGAGCTGGAGTTCGTCGCGGTCAACGTCTCCAGCCGG
CTGTTCAACCGCGGCGGCCTGGAAGAAAGGATCGCCAACGCCCTGGAAGAGTCCGGGCTGGAGCCCCGCTACCTGGAGCTGGAAGTCACCGAAAGCGCGG
TGATGGAGGACTTCGAACAGTCCCTCAACCTGCTCTGCCGCCTGCGCATCCTCGGCGTGAACCTGGCCATCGACGACTTCGGCACCGGCTATTCCTCGCT
GATGCGCCTCAAGCGGCTGCCGGTACACAAGCTGAAGATCGACCAGGGCTTCGTCGCCGGCCTGCCCGGCGCGGTGGACGACGCCGCGATCGCCCGTGCG
ATCGTTGCCCTGGCGCAAAGCATGGGCCTGCGGGTGGTTGCCGAGGGTATCGAGCACCAGGACCAGGCGCTGTTCCTGCGCGAACATGGCTGCGACTTCG
GCCAAGGCTACTGGTACGGACGGCCGCAACCGGCGGAAGCGCTGCGCTTCGACCTGCCGCCCGTGGCGCTGCCGGAAGACTGA


BLAST search against this genome or other genomes in database

Downstream 500 BP region GCCTGGCGGCGAAGCCGGGCCGCTTCGCCGTCTTATAACCACTTTACCTATAAAGATTCTTAAACAATATTTTTAAGAATATTGCCCACTGCTTACTATG
CGCCTCACGCCGCCTCCACTTCGTCGAGCAACGCGGCACCTCGAGCCACAGGAGCAGAGACCCATGAGCGCAACCCTCAGAAGCCTGGATGGCCAGGACG
AAGCCACCATCCTGCGTGAAATCCAGAGTGCCCTGCGCGGCCTGCGCTTCGGCGCCGTCGAGATCACCGTGCACAACGGCCAGGTGGTGCAGATCGAGCG
CAAGGAAAAATTCCGTCTGCAGCAACCGGCCGTCAAGCAGGCCTGAAGCACACGACCCGACTGGACCACCGGAGGCGTCTCGCCATGAACATCCGTTCGA
TACCCCATCCGCACCGGTACTGCAGCTGTCGGCCGCGAATGCGCGCCTGACGCCCCGTGTTCCCGTCGTTCCGCCAACACCCCATTAGAACAATCGAAAC
A


Protein Sequence
Protein Sequence MSPRLSALRLSLAYLAIAIAWAFLSDHLLQNQVQDHDQLVFWMTAKRLFFFAATGLLLYLYLVRQFRRKAQAYDELHGSEQRLNRALEAVRDGLWDWDLV
TDRMFVSPGYAALIGLAPEELGDPIETWKKRLHPEEYATVLEAHRNHLQGLTDNLDHIYRLRHKDGDYRWIHSRGRVLRDALGKPLHYTGVARDITLQRL
KEDHLRQAAAVFDSTREGVLVTDAQAVIVHVNPSFERITGYRSEDVLGKTPAILRSGRQDQAFYQRLWLALREQDVWSGEIWNRRKSGEIYPQWLHIRAV
RNDQGQLTHYVGVFSDLSSIKRSENELDFLAHHDSLTGLPNRVLLRERIEQALENGKDRTVAGALLLIDLDHFKHINDSLGHTTGDMLLKEVSKRLQHQL
DERCLLSRLGGDEFAILVENDDPEAVARLSQRILDGFNAPFDIHCQPIYISASLGVSLYPEDASDVDHLMQHADAALFQAKDSGRNAYAFYTRVLTARAR
AHVQVESALRHALEHDELRVHYQPVHDLASGRIVGVESLVRWQHPERGLVPPGEFVPVAEECGLIAALDNWVLKRACRQMREWQQRGVELEFVAVNVSSR
LFNRGGLEERIANALEESGLEPRYLELEVTESAVMEDFEQSLNLLCRLRILGVNLAIDDFGTGYSSLMRLKRLPVHKLKIDQGFVAGLPGAVDDAAIARA
IVALAQSMGLRVVAEGIEHQDQALFLREHGCDFGQGYWYGRPQPAEALRFDLPPVALPED


BLAST search against this genome or other genomes in database
Precomputed BLAST results at BLINK