Please note that we will be retiring this old site on Tuesday, August 25th, 2015.
At that point, the URL for www.pseudomonas.com will bring you to our new site currently hosted at beta.pseudomonas.com. We encourage you to visit the new site now and see a more recent set of updated gene annotations and MANY more Pseudomonas strains.
Pseudomonas Genome Database - Annotation for PA0336
               gene PA0336                
Add this annotation to your clipboard
Key to gene image


View in GBrowse: (?)
47 putative orthologs Acknowledgements for this annotation
Feature Overview
Strain Pseudomonas aeruginosa PAO1 (Tax ID: 208964) Replicon Pseudomonas aeruginosa PAO1 chromosome, complete genome.
(5688 genes, 6264404 bp) [ RefSeq ]
Feature type gene  Genomic location 378096 - 378575 (+ strand)
Name ygdP  (View this annotation at our new website) Alternate Names
Locus tag PA0336 (View 4 updates) Submit an Update Tranposon Mutant Available? 1 mutant(s) available.
Product Information
Feature type CDS
Product Name Nudix hydrolase YgdP
Product Name Confidence Class 2: Function of highly similar gene experimentally demonstrated in another organism (and gene context consistent in terms of pathways its involved in, if known).
Alternate Names dinucleoside oligophosphate pyrophosphatase

Charge at pH 7 (Predicted):4.17
Kyte-Doolittle Hydropathy Score (Predicted):-0.500
Molecular Weight (Predicted):18.7 kDa
Isoelectric Point (Predicted):9.51
Subcellular localization
CompartmentTypeConfidence LevelExplanation of Localization Confidence
Cytoplasmic Primary Class 3: Subcellular localization computationally predicted by PSORTb V3.0.
Orthologs/Comparative Genomics
Pseudomonas Ortholog Group Explanation of Orthologous Groups
Number of Orthologs in Pseudomonas species 47 putative orthologs
OrtholugeDB (New!) Explanation of Orthologous Groups
Secondary Genomic Features contained in PA0336
Name Sequence Start Stop Strand PubMed IDs Cross Reference Other Notes
Inverted repeat (palindrome) of 378366..378356
Retrieve 378310 378320 + 10827456
Software: Palindrome (Emboss 6.2.0)
Inverted repeat (palindrome) of 378310..378320
Retrieve 378356 378366 - 10827456
Software: Palindrome (Emboss 6.2.0)
Confirmed ISlacZ/hah insertion site
378366 378366 + 14617778
UWGC: 19146
Confirmed ISlacZ/hah insertion site
378568 378568 - 14617778
UWGC: 17472
Alternate Annotations and Cross-References
GI 15595533
Precomputed BLAST results NCBI BLINK
RefSeq NP_249027
TIGR NTL03PA00337
UniProtKB Acc Q9X4P2
UniProtKB ID RPPH_PSEAE
Affymetrix PA0336_at
KEGG PA0336
GBrowse Click GBrowse for a GBrowse View of this and other annotations.
PseudoCyc Click here to view metabolic pathways in PseudoCyc.
Gene Ontology (GO) - Participate in the 2014 Gene Ontology Annotation initiative and get your name on a consortium publication!
GO Accession GO Term Evidence
Code
Reviewed
by curator?
Reference
Molecular Function
GO:0003824 catalytic activity RCA No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides IEA No
Biological Process
GO:0008152 metabolic process RCA No
GO:0009117 nucleotide metabolic process ISS No
Cellular Component
Function Classification
PseudoCAP Function Class Nucleotide biosynthesis and metabolism
Pathways
Pathways Explanation of Pathways Field
Name Database Xref
RNA degradation KEGG pae03018 Computationally Generated
Homology
BLINK Precomputed BLAST results at BLINK
Homologs Explanation of Homologs Field 81% similar to putative invasion protein YgdP, a member of the Nudix hydrolase subfamily of dinucleoside oligophosphate pyrophosphatases [Escherichia coli]
Structure Features
Structure Features Explanation of Structure Features Field PS00893: mutT domain signature
CDD predictions Explanation of CDD predictions
CDD Accession External Accession Database Short Name Description Start Stop E-value Release Number
234820 PRK00714 PRK PRK00714 RNA pyrophosphohydrolase; Reviewed 1 156 1e-72 3.10
239643 cd03671 CD Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily 6 151 5e-54 3.10
215841 pfam00293 Pfam NUDIX NUDIX domain 7 150 1e-15 3.10
223568 COG0494 COG MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] 13 157 9e-10 3.10
 
Microarray Expression Data
NCBI GEO Link
DNA Sequence
Upstream 500 BP Region GCTCGGCGAGCAGCGCCTCGCCCTTGGCCAGCACGATCGGCTCGATCACTTCCTGCATGAACTGGCGGTGCCAGGTTTCCAGCTGGGCCATCTCGGTGCG
ACCGAGGATCGCCTGGGTGAAGGCCTGGTAGGCAAGGACGTCGAGCTTGCCGGCGACGTAGTCGGCATAGAAGGCGTCGTTGCGCGCCTGGTATTCGGCG
GCGTCGACCAGGCCGCGCTGGCACAGCCATTCGCCCCAGCTATGGTCGCTGTCGCCGGCGAGCAGGGTGTTATCGAGATCGAAAAGGGCCAGACGCACGG
GGTGACTCCATCGGTTGGCGGGTGGCGGAAGGGCCGCGAGAGCCTTTTGCGAAGGCTCCCACCGGGCCTTGGGAAAGCCCCTAGCCTACCGGCTTTTGCC
GGCCCTGTATCCTCCCCGCACGAGTCGCAAAGCCGCGCGTTGCCGCTATCACAAGCTTTATGGAACAATGCGGGCACATGCGATTTCGAGGATGTCCCAG
C


BLAST search against this genome or other genomes in database
Need more than 500 BP? Try our sequence retrieval tool or view intergenic regions in GBrowse.

DNA Sequence GTGATCGATTCCGATGGTTTTCGCCCGAATGTCGGCATCATTCTCGCCAACGAGGCGGGGCAGGTGCTGTGGGCGCGGCGTATCAATCAGGAAGCCTGGC
AGTTCCCGCAGGGAGGCATCAATGATCGCGAAACGCCGGAAGAGGCGCTGTATCGCGAGTTGAACGAAGAAGTCGGGCTGGAGGCCGGGGACGTGCGCAT
CCTGGCCTGCACCCGCGGCTGGCTGCGCTACCGTTTGCCGCAGCGCCTGGTGCGGACCCACAGCCAGCCGCTGTGCATCGGCCAGAAGCAGAAATGGTTC
CTGCTGCGGCTGATGTCCGACGAGGCGCGCGTGCGCATGGATATCACCAGCAAGCCCGAGTTCGACGGCTGGCGCTGGGTGAGTTACTGGTACCCCCTGG
GACAGGTGGTGACCTTCAAGCGCGAGGTCTACCGCCGCGCCCTGAAGGAACTGGCCCCGCGCCTTCTGGCGCGGGACTGA


BLAST search against this genome or other genomes in database

Downstream 500 BP region ACACGGAGACAAGGCCCCGAGCATGCTCAACACGCTGCGCAAGATCGTCCAGGAAGTGAACTCCGCCAAGGATCTGAAGGCGGCGCTGGGCATCATCGTG
CAGCGGGTCAAGGAAGCCATGGGTACCCAGGTCTGCTCGGTGTACCTGCTCGACACCGAGACCCAGCGTTTCGTCCTGATGGCCACCGAAGGCCTCAACA
AGCGTTCCATCGGCAAGGTCAGCATGGCTCCCAGCGAAGGCCTGGTCGGCCTGGTCGGCACCCGCGAGGAGCCGCTCAACCTGGAGAACGCCGCCGCCCA
CCCGCGCTACCGCTATTTCGCCGAGACCGGCGAGGAGCGCTACGCGTCGTTCCTCGGCGCGCCGATCATCCACCATCGGCGGGTGATGGGGGTGCTGGTG
GTGCAGCAGAAGGAGCGCCGCCAGTTCGACGAAGGCGAGGAAGCCTTCCTCGTCACCATGAGCGCCCAGCTCGCCGGGGTCATCGCGCATGCCGAGGCGA
C


Protein Sequence
Protein Sequence MIDSDGFRPNVGIILANEAGQVLWARRINQEAWQFPQGGINDRETPEEALYRELNEEVGLEAGDVRILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWF
LLRLMSDEARVRMDITSKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLARD


BLAST search against this genome or other genomes in database
Precomputed BLAST results at BLINK
Operons/Regulons
1) ygdP-ptsP-PA0338 ( View in GBrowse  )
Genomic Location: From 378096 to 382033 bp on + strand
Genes:
PA0336 (ygdP) PA0337 (ptsP) PA0338 (PA0338)
Estimated Length: 3937 bp (From 378096 to 382033 bp)
Evidence:
Class 3: Computationally-predicted.
 [PubMed:18988623]
Cross Reference: DOOR (No external cross-reference is available).  
References
PubMed The gene ygdP, associated with the invasiveness of Escherichia coli K1, designates a Nudix hydrolase, Orf176, active on adenosine (5')-pentaphospho-(5')-adenosine (Ap5A).
Bessman MJ, Walsh JD, Dunn CA, Swaminathan J, Weldon JE, Shen J.
J Biol Chem. 2001 Oct 12;276(41):37834-8.
PMID: 11479323