Please note that we will be retiring this old site on Tuesday, August 25th, 2015.
At that point, the URL for www.pseudomonas.com will bring you to our new site currently hosted at beta.pseudomonas.com. We encourage you to visit the new site now and see a more recent set of updated gene annotations and MANY more Pseudomonas strains.
Pseudomonas Genome Database - Annotation for PA2492
               gene PA2492                
Add this annotation to your clipboard
Key to gene image


View in GBrowse: (?)
44 putative orthologs Acknowledgements for this annotation
Feature Overview
Strain Pseudomonas aeruginosa PAO1 (Tax ID: 208964) Replicon Pseudomonas aeruginosa PAO1 chromosome, complete genome.
(5688 genes, 6264404 bp) [ RefSeq ]
Feature type gene  Genomic location 2807469 - 2808512 (+ strand)
Name mexT  (View this annotation at our new website) Alternate Names
Locus tag PA2492 (View 5 updates) Submit an Update Tranposon Mutant Available? 1 mutant(s) available.
Product Information
Feature type CDS
Product Name transcriptional regulator MexT
Product Name Confidence Class 1: Function experimentally demonstrated in this species.
Alternate Names
Charge at pH 7 (Predicted):6.19
Kyte-Doolittle Hydropathy Score (Predicted):-0.405
Molecular Weight (Predicted):38.2 kDa
Isoelectric Point (Predicted):10.02
Subcellular localization
CompartmentTypeConfidence LevelExplanation of Localization Confidence
Cytoplasmic Primary Class 2: Subcellular localization of highly similar gene experimentally demonstrated in another organism OR to a paralog experimentally demonstrated in the same organism. BLAST expect value of 10e-10 for query within 80-120% of subject length.
Cytoplasmic Primary Class 3: Subcellular localization computationally predicted by PSORTb V3.0.
Orthologs/Comparative Genomics
Pseudomonas Ortholog Group Explanation of Orthologous Groups
Number of Orthologs in Pseudomonas species 44 putative orthologs
OrtholugeDB (New!) Explanation of Orthologous Groups
Secondary Genomic Features contained in PA2492
Name Sequence Start Stop Strand PubMed IDs Cross Reference Other Notes
-35 region
Retrieve 2807473 2807478 - 10515918
PRODORIC: PT000008
Confirmed ISlacZ/hah insertion site
2807624 2807624 + 14617778
UWGC: 8076
Confirmed ISlacZ/hah insertion site
2807624 2807624 + 14617778
UWGC: 8280
Alternate Annotations and Cross-References
GI 15597688
Precomputed BLAST results NCBI BLINK
RefSeq NP_251182
TIGR NTL03PA02492
UniProtKB Acc Q9I0Z0
UniProtKB ID Q9I0Z0_PSEAE
Affymetrix PA2492_mexT_at
KEGG PA2492
GBrowse Click GBrowse for a GBrowse View of this and other annotations.
PseudoCyc Click here to view metabolic pathways in PseudoCyc.
Gene Ontology (GO) - Participate in the 2014 Gene Ontology Annotation initiative and get your name on a consortium publication!
GO Accession GO Term Evidence
Code
Reviewed
by curator?
Reference
Molecular Function
Biological Process
GO:0006355 regulation of transcription, DNA-templated IDA No
GO:0045893 positive regulation of transcription, DNA-templated IEA No
GO:0050709 negative regulation of protein secretion IMP Yes
GO:0045861 negative regulation of proteolysis IMP Yes
GO:1900377 negative regulation of secondary metabolite biosynthetic process IMP Yes
Cellular Component
Function Classification
PseudoCAP Function Class Transcriptional regulators
Homology
BLINK Precomputed BLAST results at BLINK
Homologs Explanation of Homologs Field 100% similar to a region of MexT protein [Pseudomonas aeruginosa]
Structure Features
Structure Features Explanation of Structure Features Field PS00044: Bacterial regulatory proteins, lysR family signature
CDD predictions Explanation of CDD predictions
CDD Accession External Accession Database Short Name Description Start Stop E-value Release Number
223656 COG0583 COG LysR Transcriptional regulator [Transcription] 80 337 1e-17 3.10
181918 PRK09508 PRK leuO leucine transcriptional activator; Reviewed 80 343 1e-12 3.10
217576 pfam03466 Pfam LysR_substrate LysR substrate binding domain 144 337 1e-08 3.10
176153 cd08464 CD PBP2_DntR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold 144 340 6e-55 3.10
 
Microarray Expression Data
NCBI GEO Link
DNA Sequence
Upstream 500 BP Region ATAGGCCACCAGCAGGCCGGTGTAGTAGACGCTGGCCTCCACCGGGGTGAGTACCTCGGGGTAGACCGCCAGGGCCGCGCGCGGCATCAGCACCACGTCG
CCATAGGCCGGATAATGATCGGGGGTATGGGCGGGGAAACTGGCCACGCGGGAACCCAGCGGCAGGTCGCCGACGCCGGCGCCGACCGCCAGCACCTCGC
CGGCCAGTTCGAAGCCGAGACCGGACGGCAGCGCAGCCTGCTCCGGGGCCAGGTTCTGACGCCAGAGCACATCCTTCCAGCTCACGCCGATCGCCTGGAC
ACGCACCAGGACTTCCCCTGCGGCCGGCGCCGGGGTCGGCAGCTCTTCGCATTTGAGGACCTCTGGCGGGCCAAACTGATGAAAACGGATCACTCGGGAC
ATCGCAAACCTCTGCAGTGCATCACGGGGTGAATAACCTCATGGGTTGTGACTGTATCCGCCCATGCCTGACAAAACCACCCGTCGTTATTGATAATGGC
T


BLAST search against this genome or other genomes in database
Need more than 500 BP? Try our sequence retrieval tool or view intergenic regions in GBrowse.

DNA Sequence ATGCCTGTCAGTGATCCTATGCCCCTCCGGCACCTCGCCAGGCCCCGCCCCGTCTCGCACGCAAGGCTTGACGGCGAGCCCCCGCGGTTGCAGCCTCTAG
CCCCTGGAAACGAGGAACGCCATGAACCGAAACGACCTGCGCCGCGTCGATCTGAACCTGCTGATCGTGTTCGAGACCCTGATGCACGAACGCAGCGTGA
CCCGCGCCGCAGAGAAACTGTTCCTCGGCCAGCCGGCCAGCCGGCCATCAGCGCCGCGCTGTCGCGCCTGCGCACGCTGTTCGACGACCCGCTGTTCGTC
CGTACCGGACGCAGCATGGAGCCCACCGCGCGAGCCCAGGAAATCTTCGCCCACCTGTCGCCGGCGCTGGATTCCATCTCCACCGCCATGAGTCGCGCCA
GCGAGTTCGATCCGGCGACCAGCACCGCGGTGTTCCGCATCGGCCTTTCCGACGACGTCGAGTTCGGCCTGTTGCCGCCCCTGCTCCGCCGCCTGCGCGC
GGAGGCGCCGGGGTTCGTCCTCGTCGTGCGCCGCGCCAACTATCTATTGATGCCGAACCTGCTGGCCTCGGGGGAGATCTCGGTGGGCGTCAGCTACACC
GACGAACTGCCGGCCAACGCCAAGCGCAAGACCGTGCGCCGCAGCAAGCCGAAGATCCTCCGCGCCGACTCCGCGCCCGGCCAGCTGACCCTCGACGACT
ATTGCGCGCGACCGCACGCGCTGGTGTCCTTCGCCGGCGACCTCAGCGGCTTCGTCGACGAGGAGCTGGAAAAATTCGGCCGCAAGCGCAAGGTGGTCCT
GGCGGTGCCGCAGTTCAACGGCCTCGGCACCCTCCTGGCCGGCACCGACATCATCGCCACCGTGCCCGACTACGCCGCCCAGGCGCTGATCGCCGCCGGC
GGCCTACGCGCCGAGGACCCACCGTTCGAGACCCGGGCCTTCGAACTGTCGATGGCTTGGCGCGGCGCCCAGGACAACGATCCGGCCGAACGCTGGCTGC
GCTCGCGGATCAGCATGTTCATCGGCGATCCGGACAGTCTCTGA


BLAST search against this genome or other genomes in database

Downstream 500 BP region GCCCTCCGGCAGCTACCCGCACGAGGCGTCGCAACGGGAAAATCGATCGCGCGCCGCGGGTGTGCGGCTTATTCCATCGAAAGCACTGTCCATAACCATC
GACTGTTACAGAAAACGAAAAACCATGTATCACTGTTCGTGATAATCAAAATCTCGTCGTTCGATTAGTTCCCTGCCGGAGCAGCCCGCAGACTTCGCCA
ATCCCGAAAAACCGACTGGCGGAGTCAAGCATGGAACAGTCATCCCACTTCTCCTGGCGCTACCCCCTCGCACTCGCGGCCGTACTGGTCCTGAGCGCCT
GCGGCAAGGCCCCGGAAACCACCCAAGGCATGGCGGCGCCCAAGGTCAGCGTCGCCGAAGTCATCGAACAACCGCTGAACGAGTGGGACGAATTCACCGG
CCGCCTGGAGGCCCCGGAGTCGGTGGAGCTGCGCCCGCGGGTGTCGGGCTACATCGACCGCGTGGCCTTCCATGAAGGCGCACTGGTGAAGAAAGGCGAC
C


Protein Sequence
Protein Sequence MPVSDPMPLRHLARPRPVSHARLDGEPPRLQPLAPGNEERHEPKRPAPRRSEPADRVRDPDARTQRDPRRRETVPRPAGQPAISAALSRLRTLFDDPLFV
RTGRSMEPTARAQEIFAHLSPALDSISTAMSRASEFDPATSTAVFRIGLSDDVEFGLLPPLLRRLRAEAPGFVLVVRRANYLLMPNLLASGEISVGVSYT
DELPANAKRKTVRRSKPKILRADSAPGQLTLDDYCARPHALVSFAGDLSGFVDEELEKFGRKRKVVLAVPQFNGLGTLLAGTDIIATVPDYAAQALIAAG
GLRAEDPPFETRAFELSMAWRGAQDNDPAERWLRSRISMFIGDPDSL


BLAST search against this genome or other genomes in database
Precomputed BLAST results at BLINK
References
PubMed Characterization of MexE-MexF-OprN, a positively regulated multidrug efflux system of Pseudomonas aeruginosa.
Köhler T, Michéa-Hamzehpour M, Henze U, Gotoh N, Curty LK, Pechère JC.
Mol Microbiol. 1997 Jan;23(2):345-54.
PMID: 9044268
MexT regulates the type III secretion system through MexS and PtrC in Pseudomonas aeruginosa.
Jin Y, Yang H, Qiao M, Jin S.
J Bacteriol. 2011 Jan;193(2):399-410.
PMID: 21075931