Please note that we will be retiring this old site on Tuesday, August 25th, 2015.
At that point, the URL for www.pseudomonas.com will bring you to our new site currently hosted at beta.pseudomonas.com. We encourage you to visit the new site now and see a more recent set of updated gene annotations and MANY more Pseudomonas strains.
Pseudomonas Genome Database - Annotation for PA3140
               gene PA3140                
Add this annotation to your clipboard
Key to gene image


View in GBrowse: (?)
47 putative orthologs Acknowledgements for this annotation
Feature Overview
Strain Pseudomonas aeruginosa PAO1 (Tax ID: 208964) Replicon Pseudomonas aeruginosa PAO1 chromosome, complete genome.
(5688 genes, 6264404 bp) [ RefSeq ]
Feature type gene  Genomic location 3524161 - 3524490 (- strand)
Name   (View this annotation at our new website) Alternate Names
Locus tag PA3140 (View 7 updates) Submit an Update Tranposon Mutant Available? No mutants described yet.
Product Information
Feature type CDS
Product Name hypothetical protein
Product Name Confidence Class 4: Homologs of previously reported genes of unknown function, or no similarity to any previously reported sequences.
Alternate Names
Charge at pH 7 (Predicted):1.43
Kyte-Doolittle Hydropathy Score (Predicted):0.465
Molecular Weight (Predicted):11.4 kDa
Isoelectric Point (Predicted):8.52
Subcellular localization
CompartmentTypeConfidence LevelExplanation of Localization Confidence
Unknown Primary Class 3: Subcellular localization computationally predicted by PSORTb V3.0.
Orthologs/Comparative Genomics
Pseudomonas Ortholog Group Explanation of Orthologous Groups
Number of Orthologs in Pseudomonas species 47 putative orthologs
OrtholugeDB (New!) Explanation of Orthologous Groups
Alternate Annotations and Cross-References
GI 15598336
Precomputed BLAST results NCBI BLINK
RefSeq NP_251830
TIGR NTL03PA03140
UniProtKB Acc Q9HZ87
UniProtKB ID Q9HZ87_PSEAE
DNASU PaCD00007379
Affymetrix PA3140_at
KEGG PA3140
GBrowse Click GBrowse for a GBrowse View of this and other annotations.
PseudoCyc Click here to view metabolic pathways in PseudoCyc.
Gene Ontology (GO) - Participate in the 2014 Gene Ontology Annotation initiative and get your name on a consortium publication!
Function Classification
PseudoCAP Function Class Hypothetical, unclassified, unknown
Homology
BLINK Precomputed BLAST results at BLINK
Most Similar Human Homolog
ENSP00000441272, Percent Identity: 38.18%, E-Value: 5e-06, Ensembl Release: 73.
Structure Features
Structure Features Explanation of Structure Features Field PSORT predicted signal peptide
type I export signal computationally predicted by LipoP v.1.0 (cleavage after residue 22)
type I export signal computationally predicted by Phobius (cleavage after residue 22)
type I export signal computationally predicted by SignalP v.3.0 Hidden Markov Models (cleavage after residue 22)
CDD predictions Explanation of CDD predictions
CDD Accession External Accession Database Short Name Description Start Stop E-value Release Number
224472 COG1555 COG ComEA DNA uptake protein and related DNA-binding proteins [DNA replication, recombination, and repair] 1 108 2e-19 3.10
129520 TIGR00426 TIGRFAM TIGR00426 competence protein ComEA helix-hairpin-helix repeat region 44 108 3e-14 3.10
205097 pfam12836 Pfam HHH_3 Helix-hairpin-helix motif 45 106 3e-15 3.10
 
Microarray Expression Data
NCBI GEO Link
DNA Sequence
Upstream 500 BP Region TGCGTTCCGAGCGTTCGCCCCATGGTGACATCGCCATCGAGTTCAGTGGCCTGCGTCCTGGCGAGAAGCTCTACGAAGAGCTGCTGATCGGTGACAACGT
GAATCCCACCGACCATCCGATGATCATGCGGGCCAACGAGGAACACCTGAGCTGGGAGGCCTTCAAGGTCGTGCTGGAGCAGTTGCTGGCCGCCGTGGAG
AAGGACGACTACTCGCGGGTTCGCCAGTTGCTGCGGGAAACCGTCAGCGGCTATGCGCCTGACGGTGAAATCGTCGACTGGATCTATCGCCAGAGGCGGC
GAGAACCCTGAGTCATCGTTCTCCGGAAAAGGCCGCCTAGCGGCCTTTTTTGTTTTCTCCGTACGATGTTTCCGGTGCCGGACCAGGAAGCGACTGCTTT
GCTGGGGCTGTCGATCCAGGTGCGTTCCACGGCGATAAGGTGGTTTCGTGGATGGGCATGAAGCCCTCTACGTGGTCATTCATCTCTGAAGGAGTGCACC
C


BLAST search against this genome or other genomes in database
Need more than 500 BP? Try our sequence retrieval tool or view intergenic regions in GBrowse.

DNA Sequence ATGCACCTAATCAAATCCGCTCTGCTTCTCATCCTGTTCGCCTGTCTTCCGTTTTCGGCTTCCGCCGCACCGGTCGCCGTCGCCAAGAATCCGCTGGCCG
CAACGACACCTGCGACGACCGTGTCGCCGGGGGAGCAGGTCAATATCAATACGGTCGACGAGGCCGCCCTGATACGGGGGCTCAACGGTGTCGGCGAGGC
CAAGGCCAGGGCGATCCTCGAGTATCGTGCGGCCCATGGTCCGTTCGTCTCGGTGGATCAACTGCTGGAAGTGAAAGGGGTAGGCCCGGCGTTGCTGGAG
AAGAACCGGGCGCGGATCGTCATCGAGTGA


BLAST search against this genome or other genomes in database

Downstream 500 BP region GGTGCGACTGAAGGGGCGAACTTTCGTCCCGATAACGAAAAAGCCCCCGGCATGTGCCGAGGGCTTTGAATTTGGCTCCGCGACCTGGACTCGAACCAGG
GACCCAATGATTAACAGTCATTTGCTCTACCGACTGAGCTATCGCGGAACAGCGAGGCGTATGTTACTGATTAAAAAGGGGAAGTCAAGCCTCTCCCGAT
GACTTCCCCATTTTCCCTACAGGACCTGGACGATGGCCTTGGTGATGGTCTCCAGGTTCGATTTGTTCAGCGCGGCGACGCAGATACGGCCGGTGCTGAC
GGCGTAGATACCGAACTCGGTCTTCAGGCGCTCGACCTGGTCGGCGGTCAGGCCGGAATAGGAGAACATGCCACGTTGGCGACCGACGAAGCTGAAGTCG
CGCTTGGCGCCGTGGGCTGCCAGTTGCTCGACCATCGCCAGGCGCATGTCGCGGATGCGGTCGCGCATCTCGCCCAGTTCCTGCTCCCAGAGGGCCCGCA
G


Protein Sequence
Protein Sequence MHLIKSALLLILFACLPFSASAAPVAVAKNPLAATTPATTVSPGEQVNINTVDEAALIRGLNGVGEAKARAILEYRAAHGPFVSVDQLLEVKGVGPALLE
KNRARIVIE


BLAST search against this genome or other genomes in database
Precomputed BLAST results at BLINK
References
PubMed Genome-wide identification of Pseudomonas aeruginosa exported proteins using a consensus computational strategy combined with a laboratory-based PhoA fusion screen.
Lewenza S, Gardy JL, Brinkman FS, Hancock RE.
Genome Res. 2005 Feb;15(2):321-9.
PMID: 15687295