Please note that we will be retiring this old site on Tuesday, August 25th, 2015.
At that point, the URL for www.pseudomonas.com will bring you to our new site currently hosted at beta.pseudomonas.com. We encourage you to visit the new site now and see a more recent set of updated gene annotations and MANY more Pseudomonas strains.
Pseudomonas Genome Database - Annotation for PA3161
               gene PA3161                
Add this annotation to your clipboard
Key to gene image


View in GBrowse: (?)
46 putative orthologs Acknowledgements for this annotation
Feature Overview
Strain Pseudomonas aeruginosa PAO1 (Tax ID: 208964) Replicon Pseudomonas aeruginosa PAO1 chromosome, complete genome.
(5688 genes, 6264404 bp) [ RefSeq ]
Feature type gene  Genomic location 3547689 - 3547973 (- strand)
Name himD  (View this annotation at our new website) Alternate Names
Locus tag PA3161 (View 7 updates) Submit an Update Tranposon Mutant Available? 1 mutant(s) available.
Product Information
Feature type CDS
Product Name integration host factor beta subunit
Product Name Confidence Class 1: Function experimentally demonstrated in this species.
Alternate Names
Charge at pH 7 (Predicted):3.71
Kyte-Doolittle Hydropathy Score (Predicted):-0.646
Molecular Weight (Predicted):10.6 kDa
Isoelectric Point (Predicted):10.21
Subcellular localization
CompartmentTypeConfidence LevelExplanation of Localization Confidence
Cytoplasmic Primary Class 3: Subcellular localization computationally predicted by PSORTb V3.0.
Orthologs/Comparative Genomics
Pseudomonas Ortholog Group Explanation of Orthologous Groups
Number of Orthologs in Pseudomonas species 46 putative orthologs
OrtholugeDB (New!) Explanation of Orthologous Groups
Secondary Genomic Features contained in PA3161
Name Sequence Start Stop Strand PubMed IDs Cross Reference Other Notes
ISphoA/hah insertion site
3547784 3547784 + 14617778
UWGC: 49243
Alternate Annotations and Cross-References
GI 15598357
Precomputed BLAST results NCBI BLINK
RefSeq NP_251851
TIGR NTL03PA03161
UniProtKB Acc Q51473
UniProtKB ID IHFB_PSEAE
DNASU PaCD00007391
Affymetrix PA3161_himD_at
KEGG PA3161
GBrowse Click GBrowse for a GBrowse View of this and other annotations.
PseudoCyc Click here to view metabolic pathways in PseudoCyc.
Gene Ontology (GO) - Participate in the 2014 Gene Ontology Annotation initiative and get your name on a consortium publication!
GO Accession GO Term Evidence
Code
Reviewed
by curator?
Reference
Molecular Function
Biological Process
GO:0075713 establishment of integrated proviral latency IEA No
GO:0006259 DNA metabolic process ISS Yes
GO:0016070 RNA metabolic process ISS Yes
GO:0044267 cellular protein metabolic process ISS Yes
Cellular Component
Function Classification
PseudoCAP Function Class Translation, post-translational modification, degradation
Transcription, RNA processing and degradation
DNA replication, recombination, modification and repair
Homology
BLINK Precomputed BLAST results at BLINK
Structure Features
Structure Features Explanation of Structure Features Field PS00045: Bacterial histone-like DNA-binding proteins signature
CDD predictions Explanation of CDD predictions
CDD Accession External Accession Database Short Name Description Start Stop E-value Release Number
197709 smart00411 SMART BHL bacterial (prokaryotic) histone like domain 1 91 2e-30 3.10
178925 PRK00199 PRK ihfB integration host factor subunit beta; Reviewed 1 91 8e-49 3.10
130061 TIGR00988 TIGRFAM hip integration host factor, beta subunit 1 94 7e-44 3.10
215796 pfam00216 Pfam Bac_DNA_binding Bacterial DNA-binding protein 1 91 9e-27 3.10
223847 COG0776 COG HimA Bacterial nucleoid DNA-binding protein [DNA replication, recombination, and repair] 1 93 2e-32 3.10
238332 cd00591 CD HU_IHF Integration host factor (IHF) and HU are small heterodimeric members of the DNABII protein family that bind and bend DNA, functioning as architectural factors in many cellular processes including transcription, site-specific recombination, and higher-order nucleoprotein complex assembly 2 89 1e-28 3.10
 
Microarray Expression Data
NCBI GEO Link
DNA Sequence
Upstream 500 BP Region ATCCGTTCTCCAACTACGCGTCCCTGCACGAGAAAGGCAGCATCGTCCGCGGTACCGTGAAGGAAGTCGACGCCAAGGGCGCTGTCATCAGCCTGGGCGA
CGACATCGAAGGTATCCTGAAGGCTTCCGAAATCAGCCGTGACCGCGTCGAAGACGCGCGCAACGTCCTGAAGGAAGGCGAGGAAGTCGAAGCCAAGATC
ATCAGCATCGACCGCAAGAGCCGCGTCATCAGCCTCTCCGTCAAGTCCAAGGACGTCGACGACGAGAAGGACGCAATGAAAGAACTGCGTAAGCAGGAAG
TAGAAAGCGCTGGTCCGACCACCATCGGTGATCTGATCCGTGCTCAGATGGAGAATCAGGGCTAAGTCTCTGATCCATCATGAAAAAGGGCGGCCTAGGC
CGCCCTTTTTCGTTTTCCCCTTCTTGGACCTGTTCAAAGACTGATCAGCATGCTAAAAGAGACCTGAGCTGATCTAGCCGCTTGAAAAAGAAGGGAAAAC
C


BLAST search against this genome or other genomes in database
Need more than 500 BP? Try our sequence retrieval tool or view intergenic regions in GBrowse.

DNA Sequence ATGACCAAGTCGGAGTTGATCGAACGGATCGTTACCCATCAGGGGCAACTGTCCGCGAAGGATGTCGAGTTGGCAATCAAGACCATGCTGGAGCAAATGT
CCCAGGCCCTGGCGACCGGGGACCGGATCGAGATCCGTGGCTTCGGCAGCTTTTCCTTGCACTACCGCGCCCCGCGCGTCGGTCGCAACCCCAAGACCGG
GGAGTCGGTACGCCTCGACGGCAAGTTCGTGCCGCACTTCAAGCCGGGCAAGGAGTTGCGGGATCGGGTCAACGAGCCGGAGTGA


BLAST search against this genome or other genomes in database

Downstream 500 BP region TCTCTGCCTTGTTCAGATGTTGGAGTTGCCATGCTTTGGGTCAAGCGTACGTTAATGGCGGTGGGGCTGTTAGTTGTCGCCCTTTTCATGATTGTGGTTG
CTTTGGAGAACCGGCAAAGCGTCAGCTTTGAACTCTTTGGTCTTGCCACGCCAGATTTACCTGTGGTCCTTTATGTTGCGTTAGCATTTATTGCTGGCGG
TATTATTGGTATGTTGATCAGCGTGCCTCTTCTGGCTCGTGCCAAAGTGCGTCTCAGATCTGCAAGATCTGATCTGTCTCGTACTCGAAAAGAACTCGCA
GTATCTCAGTCTACCGCCCTGCGGTGAGGTCTGCTCGAGTCCCTGCCTGGTCTTTGTGGGCTCGAGTGCTATTCGCATCTAGATGACTACACAATGCTTG
GAAGGTCGGGTGGGATGGGTGTCCTGTTAGAGGGGGTGCTGAGTTACCATGTCTTACTGGTTTGGCTGGAGTCTGTAGATGGAGGCTTGGTTCATGGCAT
C


Protein Sequence
Protein Sequence MTKSELIERIVTHQGQLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGESVRLDGKFVPHFKPGKELRDRVNEPE

BLAST search against this genome or other genomes in database
Precomputed BLAST results at BLINK
References
PubMed Pseudomonas aeruginosa contains an IHF-like protein that binds to the algD promoter.
Toussaint B, Delic-Attree I, Vignais PM.
Biochem Biophys Res Commun. 1993 Oct 15;196(1):416-421.
PMID: 8216322
Cloning and sequence analyses of the genes coding for the integration host factor (IHF) and HU proteins of Pseudomonas aeruginosa.
Delic-Attree I, Toussaint B, Vignais PM.
Gene. 1995 Feb 27;154(1):61-4.
PMID: 7867950