Please note that we will be retiring this old site on Tuesday, August 25th, 2015.
At that point, the URL for www.pseudomonas.com will bring you to our new site currently hosted at beta.pseudomonas.com. We encourage you to visit the new site now and see a more recent set of updated gene annotations and MANY more Pseudomonas strains.
Pseudomonas Genome Database - Annotation for PA3544
               gene PA3544                
Add this annotation to your clipboard
Key to gene image


View in GBrowse: (?)
41 putative orthologs Acknowledgements for this annotation
Feature Overview
Strain Pseudomonas aeruginosa PAO1 (Tax ID: 208964) Replicon Pseudomonas aeruginosa PAO1 chromosome, complete genome.
(5688 genes, 6264404 bp) [ RefSeq ]
Feature type gene  Genomic location 3968449 - 3969921 (+ strand)
Name algE  (View this annotation at our new website) Alternate Names alg76
Locus tag PA3544 (View 8 updates) Submit an Update Tranposon Mutant Available? 1 mutant(s) available.
Product Information
Feature type CDS
Product Name Alginate production outer membrane protein AlgE precursor
Product Name Confidence Class 1: Function experimentally demonstrated in this species.
Alternate Names alginate production protein AlgE

Charge at pH 7 (Predicted):-20.33
Kyte-Doolittle Hydropathy Score (Predicted):-0.642
Molecular Weight (Predicted):54.4 kDa
Isoelectric Point (Predicted):4.67
Subcellular localization
CompartmentTypeConfidence LevelExplanation of Localization Confidence
Outer Membrane Primary Class 1: Subcellular localization experimentally demonstrated in Pseudomonas aeruginosa.
Outer Membrane Primary Class 3: Subcellular localization computationally predicted by PSORTb V3.0.
Orthologs/Comparative Genomics
Pseudomonas Ortholog Group Explanation of Orthologous Groups
POG002122 
Orthology uncertain because more than one top BLASTp hit was identified.
Number of Orthologs in Pseudomonas species 41 putative orthologs
OrtholugeDB (New!) Explanation of Orthologous Groups
Secondary Genomic Features contained in PA3544
Name Sequence Start Stop Strand PubMed IDs Cross Reference Other Notes
Confirmed ISphoA/hah insertion site
3969887 3969887 + 14617778
UWGC: 46526
ISphoA/hah insertion site
3969888 3969888 + 14617778
UWGC: 36041
Alternate Annotations and Cross-References
GI 15598740
Precomputed BLAST results NCBI BLINK
RefSeq NP_252234
TIGR NTL03PA03544
UniProtKB Acc P18895
UniProtKB ID ALGE_PSEAE
Affymetrix PA3544_algE_at
KEGG PA3544
GBrowse Click GBrowse for a GBrowse View of this and other annotations.
PseudoCyc Click here to view metabolic pathways in PseudoCyc.
Gene Ontology (GO) - Participate in the 2014 Gene Ontology Annotation initiative and get your name on a consortium publication!
GO Accession GO Term Evidence
Code
Reviewed
by curator?
Reference
Molecular Function
Biological Process
GO:0042121 alginic acid biosynthetic process IMP Yes
GO:0042121 alginic acid biosynthetic process ISS Yes
GO:0050896 response to stimulus ISS Yes
Cellular Component
GO:0016020 membrane ISS Yes
Function Classification
PseudoCAP Function Class Membrane proteins
Adaptation, Protection
Secreted Factors (toxins, enzymes, alginate)
Pathways
Pathways Explanation of Pathways Field
Name Database Xref
Alginate biosynthesis PseudoCAP
Homology
BLINK Precomputed BLAST results at BLINK
Homologs Explanation of Homologs Field 99% similar to AlgE protein precursor [Pseudomonas aeruginosa]
Structure Features
Similarity to Known 3D Structures
Accession Database Description Method Source Percent Similarity
3RBH PDB Structure of alginate export protein AlgE from Pseudomonas aeruginosa X-RAY DIFFRACTION PSEUDOMONAS AERUGINOSA 98.4
4B61 PDB In meso structure of alginate transporter, AlgE, from Pseudomoas aeruginosa, PAO1. Crystal form 3. X-RAY DIFFRACTION PSEUDOMONAS AERUGINOSA PAO1 100
4AZL PDB In meso structure of alginate transporter, AlgE, from Pseudomoas aeruginosa, PAO1, crystal form 2. X-RAY DIFFRACTION PSEUDOMONAS AERUGINOSA 100
4AFK PDB In meso structure of alginate transporter, AlgE, from Pseudomonas aeruginosa, PAO1 X-RAY DIFFRACTION PSEUDOMONAS AERUGINOSA 100
Structure Features Explanation of Structure Features Field signal peptide
type I export signal computationally predicted by LipoP v.1.0 (cleavage after residue 32)
type I export signal computationally predicted by Phobius (cleavage after residue 32)
type I export signal computationally predicted by SignalP v.3.0 Hidden Markov Models (cleavage after residue 32)
Export across inner membrane confirmed by PhoA fusion screen
CDD predictions Explanation of CDD predictions  
Microarray Expression Data
NCBI GEO Link
DNA Sequence
Upstream 500 BP Region CCAGCCACGCGCCGAACTGCTCCTCGGGCGCCTCTACTACGACGGCAAGTGGGCGCCGCAGGACCCGCGCAAGGCCGAGCGGCACCTGCTCAAGGCCGCC
GCCAGCGAACCCCAGGCCAACTACTACCTGGGGCAGATCTACCGCCGCGGCTTCCTCGGCAAGGTCTATCCGCAGAAGGCCGTCGACCACCTGATCCTCG
CCGCCCGCGCCGGCCAGGCCAGCGCCGACATGGCCCTGGCCCAGCTCTGGTCGCAGGGCCGCGGCATCCAGCCGAACCGGGTCAACGCCTACGTCTTCGG
CCAGCTCGCCGTGCAGCAGCAGGTACCGCAGGCCAGCGACCTGCTCGGGCAGATCGAAGCGCAACTGCCGCCGGCCGAACGCAGCCAGGCGCAGCAATTG
CTCAAGCGCGAACAACAGAGCCGCGGCAACAACTGGCAGGCCACCGTCAGCCTGCTGCAGAGCCAGGACTCGCCGATCAACGAAGAAGAGCCAGAAAGCC
T


BLAST search against this genome or other genomes in database
Need more than 500 BP? Try our sequence retrieval tool or view intergenic regions in GBrowse.

DNA Sequence ATGAACAGCTCCCGTTCCGTCAACCCGCGGCCGTCCTTCGCGCCGCGCGCCCTGTCCCTGGCCATCGCCCTGCTGCTCGGCGCGCCGGCGTTCGCCGCCA
ACAGCGGCGAGGCGCCGAAGAACTTCGGCCTGGACGTGAAGATCACCGGCGAATCGGAAAACGATCGCGACCTCGGCACCGCTCCCGGCGGCACCCTCAA
CGACATCGGTATCGACCTGCGGCCCTGGGCCTTCGGCCAGTGGGGCGACTGGAGCGCCTACTTCATGGGCCAGGCGGTGGCCGCCACCGACACCATCGAG
ACCGACACCCTGCAATCGGACACCGACGACGGCAACAACAGCCGCAACGACGGTCGCGAGCCGGACAAGAGCTACCTCGCCGCACGCGAATTCTGGGTCG
ACTACGCCGGCCTCACCGCCTACCCCGGCGAGCACCTGCGCTTCGGCCGCCAGCGCCTGCGGGAAGACAGCGGCCAGTGGCAGGACACCAACATCGAGGC
GCTGAACTGGAGCTTCGAGACCACCCTGCTCAACGCCCACGCCGGGGTCGCCCAGCGTTTCAGCGAATACCGCACCGACCTCGACGAACTGGCTCCGGAG
GACAAGGACCGCACCCATGTGTTCGGCGACATTTCCACCCAGTGGGCGCCGCACCACCGCATAGGCGTGCGCATCCACCACGCCGACGACAGCGGCCACC
TGCGCCGCCCCGGCGAGGAAGTCGACAACCTCGACAAGACCTATACCGGCCAGCTCACCTGGCTCGGCATCGAGGCTACCGGCGATGCCTACAACTATCG
TTCGAGCATGCCGCTGAACTACTGGGCCAGCGCCACCTGGCTGACCGGCGACCGCGACAACCTGACCACCACCACGGTCGACGACCGGCGCATCGCCACC
GGCAAGCAGAGCGGCGACGTCAATGCCTTCGGCGTCGACCTCGGCCTGCGCTGGAACATCGACGAGCAATGGAAGGCCGGCGTCGGCTACGCCCGCGGCA
GCGGCGGTGGCAAGGACGGCGAGGAGCAGTTCCAGCAGACCGGGCTGGAGAGCAATCGCTCCAACTTCACCGGCACCCGCTCGCGCGTGCACCGCTTCGG
CGAAGCCTTCCGCGGCGAACTGAGCAACCTCCAGGCAGCCACCCTGTTCGGCTCCTGGCAACTGCGCGAGGACTACGACGCGAGCCTGGTCTACCACAAG
TTCTGGCGCGTCGACGACGACTCCGACATCGGTACCAGCGGCATCAACGCCGCCCTGCAACCGGGCGAGAAGGACATCGGCCAGGAACTCGACCTGGTGG
TGACCAAGTACTTCAAGCAAGGCCTGCTGCCGGCCTCGATGAGCCAGTACGTCGACGAGCCCTCGGCGCTGATCCGCTTCCGCGGCGGCCTGTTCAAGCC
GGGCGACGCCTACGGGCCGGGCACCGACTCGACCATGCACCGCGCCTTCGTCGACTTCATCTGGCGCTTCTGA


BLAST search against this genome or other genomes in database

Downstream 500 BP region GCCCCGCGAGGAAACCGGACATGCCCGACATTTCCCTTTCGATCCCCCGCCGCCGGCTCCCGCGCCTGCGCCCGCTGGCCGCGGCAGTGCTCGGCGCGGT
GCTGCTGCACGGCCAGGCGTGGGCGGCGCAGCCGGTGGAGAAACCGCAGCCGGTCCCGGCGCAGGCCGGCAACGAGCCGGGCCTGACCCAGGGCCTGAAG
GAAACCGGCAACTACACGGTGACCACCGCGCCGGCCGAACCGTTGCACCTGGACCCGCCGAAACTGCCCGACCTCTCCGGCTACACCGCCGCCGCGGTGG
AAGCCAAGATCGTGCGCAAGCCGGGTGGCCGCGCCAGCGTGCAGCGCATGGTCCAGCAGCAGCCGCTGAAGGAGTTCACCGGTGGCAGCAACCGCCTCGC
CGAATGGGTCAAGCGCCAGCGCCAGATGCCCCAGGCGATCTTCATCGAAGGCGGCTACGTGAACCTCGCCCAGCTCGCCGGCAAGCTTCCCGCCAGCGCG
C


Protein Sequence
Protein Sequence MNSSRSVNPRPSFAPRALSLAIALLLGAPAFAANSGEAPKNFGLDVKITGESENDRDLGTAPGGTLNDIGIDLRPWAFGQWGDWSAYFMGQAVAATDTIE
TDTLQSDTDDGNNSRNDGREPDKSYLAAREFWVDYAGLTAYPGEHLRFGRQRLREDSGQWQDTNIEALNWSFETTLLNAHAGVAQRFSEYRTDLDELAPE
DKDRTHVFGDISTQWAPHHRIGVRIHHADDSGHLRRPGEEVDNLDKTYTGQLTWLGIEATGDAYNYRSSMPLNYWASATWLTGDRDNLTTTTVDDRRIAT
GKQSGDVNAFGVDLGLRWNIDEQWKAGVGYARGSGGGKDGEEQFQQTGLESNRSNFTGTRSRVHRFGEAFRGELSNLQAATLFGSWQLREDYDASLVYHK
FWRVDDDSDIGTSGINAALQPGEKDIGQELDLVVTKYFKQGLLPASMSQYVDEPSALIRFRGGLFKPGDAYGPGTDSTMHRAFVDFIWRF


BLAST search against this genome or other genomes in database
Precomputed BLAST results at BLINK
Operons/Regulons
1) alg8-alg44-algK-algE-algG-algX-algL ( View in GBrowse  )
Genomic Location: From 3964275 to 3974117 bp on + strand
Genes:
PA3541 (alg8) PA3542 (alg44) PA3543 (algK) PA3544 (algE) PA3545 (algG) PA3546 (algX) PA3547 (algL)
Estimated Length: 9842 bp (From 3964275 to 3974117 bp)
Evidence:
Class 3: Computationally-predicted.
 [PubMed:18988623]
Cross Reference: DOOR (No external cross-reference is available).  
2) alginate biosynthesis operon ( View in GBrowse  )
Genomic Location: From 3962458 to 3979476 bp on + strand
Genes:
PA3540 (algD) PA3541 (alg8) PA3542 (alg44) PA3543 (algK) PA3544 (algE) PA3545 (algG) PA3546 (algX) PA3547 (algL) PA3548 (algI)
Estimated Length: 17018 bp (From 3962458 to 3979476 bp)
Evidence:
Class 2: A transcription unit is inferred from author statement. In this case, there is often a set of adjacent genes, encoded in the same direction, coding for products that participate in the same metabolic pathway or biological process.
 [PubMed:21991261]
Cross Reference: PseudoCAP: 41758
Genomic Context
Genomic context Explanation of Genomic Context Field - 18-kb alginate biosynthetic operon
Gene has been identified as a virulence factor
Reference Details
VFDB 2008 release: an enhanced web-based resource for comparative pathogenomics.
Yang J, Chen L, Sun L, Yu J, Jin Q.
Nucleic Acids Res. 2008 Jan;36(Database issue):D539-42.
PMID: 17984080
 
Role: Antiphagocytosis,  Role: Alginate biosynthesis, 
References
PubMed Mucoid conversion of Pseudomonas aeruginosa by hydrogen peroxide: a mechanism for virulence activation in the cystic fibrosis lung.
Mathee K, Ciofu O, Sternberg C, Lindum PW, Campbell JI, Jensen P, Johnsen AH, Givskov M, Ohman DE, Molin S, Hoiby N, Kharazmi A.
Microbiology. 1999 Jun;145 ( Pt 6):1349-57.
PMID: 10411261
Nucleotide sequence and expression of the algE gene involved in alginate biosynthesis by Pseudomonas aeruginosa.
Chu L, May TB, Chakrabarty AM, Misra TK.
Gene. 1991 Oct 30;107(1):1-10.
PMID: 1743507