Please note that we will be retiring this old site on Tuesday, August 25th, 2015.
At that point, the URL for www.pseudomonas.com will bring you to our new site currently hosted at beta.pseudomonas.com. We encourage you to visit the new site now and see a more recent set of updated gene annotations and MANY more Pseudomonas strains.
Pseudomonas Genome Database - Annotation for PA3556
               gene PA3556                
Add this annotation to your clipboard
Key to gene image


View in GBrowse: (?)
30 putative orthologs Acknowledgements for this annotation
Feature Overview
Strain Pseudomonas aeruginosa PAO1 (Tax ID: 208964) Replicon Pseudomonas aeruginosa PAO1 chromosome, complete genome.
(5688 genes, 6264404 bp) [ RefSeq ]
Feature type gene  Genomic location 3984890 - 3986539 (+ strand)
Name arnT  (View this annotation at our new website) Alternate Names pqaB
Locus tag PA3556 (View 11 updates) Submit an Update Tranposon Mutant Available? 1 mutant(s) available.
Product Information
Feature type CDS
Product Name inner membrane L-Ara4N transferase ArnT
Product Name Confidence Class 2: Function of highly similar gene experimentally demonstrated in another organism (and gene context consistent in terms of pathways its involved in, if known).
Alternate Names pmrK

Charge at pH 7 (Predicted):20.93
Kyte-Doolittle Hydropathy Score (Predicted):0.399
Molecular Weight (Predicted):61.7 kDa
Isoelectric Point (Predicted):10.10
Evidence of Translation:Detected using LC-MS/MS (61.73 kDa, PMID:21751344)
Subcellular localization
CompartmentTypeConfidence LevelExplanation of Localization Confidence
Cytoplasmic Membrane Primary Class 3: Subcellular localization computationally predicted by PSORTb V3.0.
Outer Membrane Vesicle Secondary Class 1: Subcellular localization experimentally demonstrated in Pseudomonas aeruginosa.
Orthologs/Comparative Genomics
Pseudomonas Ortholog Group Explanation of Orthologous Groups
POG002110 
Orthology uncertain because more than one top BLASTp hit was identified.
Number of Orthologs in Pseudomonas species 30 putative orthologs
OrtholugeDB (New!) Explanation of Orthologous Groups
Secondary Genomic Features contained in PA3556
Name Sequence Start Stop Strand PubMed IDs Cross Reference Other Notes
Confirmed ISlacZ/hah insertion site
3985434 3985434 - 14617778
UWGC: 16684
Confirmed ISlacZ/hah insertion site
3985721 3985721 + 14617778
UWGC: 17287
ISphoA/hah insertion site
3985812 3985812 + 14617778
UWGC: 43516
Inverted repeat (palindrome) of 3986470..3986458
Retrieve 3986434 3986446 + 10827456
Software: Palindrome (Emboss 6.2.0)
Inverted repeat (palindrome) of 3986434..3986446
Retrieve 3986458 3986470 - 10827456
Software: Palindrome (Emboss 6.2.0)
mini-Tn5 lux transposon insertion site (Transcriptional fusion)
3986506 3986506 N/A 15805499
PseudoCAP: PAO1_lux_14_B1
mini-Tn5 lux transposon insertion site (Transcriptional fusion)
3986506 3986506 N/A 15805499
PseudoCAP: PAO1_lux_14_C11
mini-Tn5 lux transposon insertion site (Transcriptional fusion)
3986506 3986506 N/A 15805499
PseudoCAP: PAO1_lux_22_F5
mini-Tn5 lux transposon insertion site (Transcriptional fusion)
3986506 3986506 N/A 15805499
PseudoCAP: PAO1_lux_39_E2
mini-Tn5 lux transposon insertion site (Transcriptional fusion)
3986506 3986506 N/A 15805499
PseudoCAP: PAO1_lux_53_B9
mini-Tn5 lux transposon insertion site (Transcriptional fusion)
3986506 3986506 N/A 15805499
PseudoCAP: PAO1_lux_68_H10
Alternate Annotations and Cross-References
GI 15598752
Precomputed BLAST results NCBI BLINK
RefSeq NP_252246
TIGR NTL03PA03556
UniProtKB Acc Q9HY61
UniProtKB ID ARNT_PSEAE
Affymetrix PA3556_at
KEGG PA3556
GBrowse Click GBrowse for a GBrowse View of this and other annotations.
PseudoCyc Click here to view metabolic pathways in PseudoCyc.
Gene Ontology (GO) - Participate in the 2014 Gene Ontology Annotation initiative and get your name on a consortium publication!
GO Accession GO Term Evidence
Code
Reviewed
by curator?
Reference
Molecular Function
Biological Process
GO:1901760 beta-L-Ara4N-lipid A biosynthetic process ISS Yes
GO:0046677 response to antibiotic ISS Yes
Cellular Component
GO:0009276 Gram-negative-bacterium-type cell wall ISS Yes
GO:0016020 membrane ISS Yes
Function Classification
PseudoCAP Function Class Adaptation, Protection
Membrane proteins
Cell wall / LPS / capsule
Homology
BLINK Precomputed BLAST results at BLINK
Homologs Explanation of Homologs Field 60% similar to unknown [Salmonella typhimurium]
60% similar to hypothetical protein [Escherichia coli]
61% similar to melittin resistance protein PqaB [Salmonella typhi]
Structure Features
Structure Features Explanation of Structure Features Field seems to have an uncleavable N-term signal seq
13 strong transmembrane helices
type I export signal computationally predicted by Phobius (cleavage after residue 26)
type I export signal computationally predicted by SignalP v.3.0 Hidden Markov Models (cleavage after residue 26)
Export across inner membrane confirmed by PhoA fusion screen
CDD predictions Explanation of CDD predictions
CDD Accession External Accession Database Short Name Description Start Stop E-value Release Number
224720 COG1807 COG ArnT 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] 1 519 1e-39 3.10
237330 PRK13279 PRK arnT 4-amino-4-deoxy-L-arabinose transferase; Provisional 1 546 3e-165 3.10
216998 pfam02366 Pfam PMT Dolichyl-phosphate-mannose-protein mannosyltransferase 7 208 2e-11 3.10
 
Microarray Expression Data
NCBI GEO Link
DNA Sequence
Upstream 500 BP Region GCAGATCCGCCGCGGCAGCGATTGCCTGGCGGACATCCTCGGCCAGCCGGTGCGTTGTTCCGCCGCCGCCGGCTGGCGCGCCGACGGCCGGGTGGTCGAG
GCCAAGCAGCCCTTCGGCTTCCGCTACAACAGCGACTGCCGCGGACGCGGCGCGTTCCGCCCGCGCCTGGCCGACGGCAGCCCTGGCATCCCGCAGGTGC
CGGTGAACCTGCCGACCTTCGACGAGGTGGTCGGTCCCGGCCTGCCGCGCGAGGCCTACAACGACTTCATCCTGGAACGCTTCGCCGCTGGCCGCGACAA
CGTCTACACCATCCACGCCGAGGTCGAGGGGCTGCTCCTCGCCCCGGCGTTCCGCGAACTGCTGCGGCGCGCCGAACGGCGCGGCATCCGCTTCCGACCG
TTGGGCGAACTGCTGCCGGACGATCCGCGCAGCCTGCCGCTGGCCGAACTGGTGCGCGGCCGCCTGGCCGGCCGCGAGGGCTGGCTGGGAGTGCGCCAGC
C


BLAST search against this genome or other genomes in database
Need more than 500 BP? Try our sequence retrieval tool or view intergenic regions in GBrowse.

DNA Sequence ATGAGCCGCCGCCAGACCTGTTCGCTGCTGCTGATCGCCTTCGGCCTGTTCTACCTGGTTCCATTGAGCAACCATGGCCTGTGGATTCCCGACGAGACCC
GCTACGCGCAGATCAGCCAGGCGATGCTGCTGGGCGGCGACTGGGTGTCGCCGCACTTCCTCGGCCTGCGCTACTTCGAGAAGCCGGTCGCCGGCTACTG
GATGATCGCCCTCGGCCAGGCGGTCTTCGGCGAAAACCTGTTCGGCGTGCGCATCGCCTCGGTCGTCGCCACCGCCCTCAGCGTCCTGCTCGCCTACCTG
CTGGCCCGCCGCCTGTGGCGCGACCCGCGCACCAGCCTGGCATGCGCGCTGCTCTACGCCAGCTTCGGCTTGATCGCCGGGCAGTCCGGCTATGCCAACC
TCGACCCGCAATTCACCTTCTGGGTCAACCTGAGCCTGGTGGCGCTGTGGCATGCCCTCGACGCGGGGAGCCGCCGCGCGCGCCTGCTCGGCTGGACCCT
GCTCGGCCTCGCCTGCGGCATGGGCTTCCTGACCAAGGGCTTCCTCGCCTGGCTGCTGCCGGTACTGGTCGCCCTGCCCTACATGCTCTGGCAGCGGCGC
TGGCGCGAGCTGCTTGGCTACGGCGCGCTGGCGGTGCTGGCGGCGCTGCTCGTCTGCCTGCCCTGGGCGCTCGCCGTGCATGCACGGGAAGCGGACTACT
GGCGGTTCTTCTTCTGGCACGAACACATCCGCCGCTTCGCCGGCGAAGACGCCCAGCACTCTCGCCCGTGGTGGTTCTACCTGCCGTTGCTGGCGGTCGC
CTGCCTGCCCTGGAGCGGCCTGCTGCCGAGCGCTCTGCGCCAGGCCTGGCACGAGCGGCGCCAGGCGCCGGTGGTCTTCCTGGCGCTATGGCTGCTGTTG
CCGCTGGCGTTCTTCAGCCTGAGCAGGGGCAAGCTGCCGACCTACATCATGCCCTGCCTGCTGCCGCTGGCACTGCTCATGGGCCACGCCCTGGTGCAGC
GGCTGCGCCTGGGGAACAGCGTCGCGCTGCGCGGCAACGGGCTGCTCAACCTGGGCCTGGCGCTCCTCGCGCTGGCGGCCCTGGCCTACCTGCAACTGCG
CAAGCCGGTGTACCAGGAAGAACCCTTCGAGCTGTTCCTGGTCCTGCTGGTGATCGGCGCCTGGGCCGCCGCCGGCCTCGCCCAGTGGCGCTACCCGCTA
CGCGCCTGGGCCGCGCCGCTGCTGGCGAGCTGGGTGCTGATCGCGCTGCTGCCGGCAGCGATGCCCAACCATGTGGTGCAGAACAAGACCCCCGACCTGT
TCGTCGCCGAACACCTCGATGAACTGACCGGCGCCCGCCATCTGCTGAGCAATGACCTCGGCGCCGCCTCGGCCCTCGCCTGGCGCCTGCGTCGTAGCGA
CGTGACGCTCTACGACACGCGCGGCGAGCTGAAGTACGGCCTCTCCTACCCCGAGCACAGCCAGCGCAGCGTGCCCTTGGCAGACATCCGCCAGTGGCTC
TGGCGGGCACGCCAGGACGGCTCGATTGCCGTGCTGCTGCGGATCAACAGCGCCAGCGACCGCTACCAGCTGGCGCTGTTGCCGGGCGACGGCGAACGCT
ACCGGAACGGCAACCTGGTCCTGGCGATCCTGCCGCAGGTGCGCCCATGA


BLAST search against this genome or other genomes in database

Downstream 500 BP region GCGCCGCGCTGCTGCTCGCCACCCTGCTCATGACCGGCCTCGGCCAGGTTGCGCAGAAGCTCACCGTGGAGCACTGGCGCCTGGTCGCCGCCGACGGCTG
GACGGCGCGCCTGCGCAGTCCGTGGCCGTGGCTGGCGCTGCTCGCCCTCGGGCTCGGCCTGCTCTGCTGGCTGCTGCTCCTGCAACGGGTGGAAGTCGGC
AGCGCCTATCCGATGCTGGCGCTGAACTTCGTCCTGGTCACCCTGGCGGCACGCTTCGTCTTCGATGAGCCGGTGGATCGCCGCCACCTCGCCGGCCTGT
TGCTGATCGTCGCCGGCGTGGCCCTGCTCGGGAGGAGCGCATGAACGCGCTACGCGGCTGGCTGGCGGCGCTGGGCAGCGTGCTGCTGGCCAGCGCCGCC
CAGCTCGGCATGCGCTGGGGCATGAGCCGCCTGCCGCTACCGGAAGCCTGGGCCGGGCAAACGCCGGAGCGCGCCGCGCTGCTCGCGGTAGCCCTGGCGG
T


Protein Sequence
Protein Sequence MSRRQTCSLLLIAFGLFYLVPLSNHGLWIPDETRYAQISQAMLLGGDWVSPHFLGLRYFEKPVAGYWMIALGQAVFGENLFGVRIASVVATALSVLLAYL
LARRLWRDPRTSLACALLYASFGLIAGQSGYANLDPQFTFWVNLSLVALWHALDAGSRRARLLGWTLLGLACGMGFLTKGFLAWLLPVLVALPYMLWQRR
WRELLGYGALAVLAALLVCLPWALAVHAREADYWRFFFWHEHIRRFAGEDAQHSRPWWFYLPLLAVACLPWSGLLPSALRQAWHERRQAPVVFLALWLLL
PLAFFSLSRGKLPTYIMPCLLPLALLMGHALVQRLRLGNSVALRGNGLLNLGLALLALAALAYLQLRKPVYQEEPFELFLVLLVIGAWAAAGLAQWRYPL
RAWAAPLLASWVLIALLPAAMPNHVVQNKTPDLFVAEHLDELTGARHLLSNDLGAASALAWRLRRSDVTLYDTRGELKYGLSYPEHSQRSVPLADIRQWL
WRARQDGSIAVLLRINSASDRYQLALLPGDGERYRNGNLVLAILPQVRP


BLAST search against this genome or other genomes in database
Precomputed BLAST results at BLINK
Operons/Regulons
1) arnB-arnC-arnA-arnD-arnT-arnE-arnF-PA3559 ( View in GBrowse  )
Genomic Location: From 3979860 to 3988684 bp on + strand
Genes:
PA3552 (arnB) PA3553 (arnC) PA3554 (arnA) PA3555 (arnD) PA3556 (arnT) PA3557 (arnE) PA3558 (arnF) PA3559 (PA3559)
Estimated Length: 8824 bp (From 3979860 to 3988684 bp)
Evidence:
Class 3: Computationally-predicted.
 [PubMed:18988623]
Cross Reference: DOOR (No external cross-reference is available).  
Genomic Context
Genomic context Explanation of Genomic Context Field - One of 7 genes homologous to a 7-gene cluster reported to be regulated by PmrA/B in Salmonella typhimurium
- 8 gene operon controlling polymyxin B and cationic antimicrobial peptide resistance
References
PubMed An inner membrane enzyme in Salmonella and Escherichia coli that transfers 4-amino-4-deoxy-L-arabinose to lipid A: induction on polymyxin-resistant mutants and role of a novel lipid-linked donor.
Trent MS, Ribeiro AA, Lin S, Cotter RJ, Raetz CR.
J Biol Chem. 2001 Nov 16;276(46):43122-3Epub 2001 Sep 4.
PMID: 11535604
PmrA-PmrB-regulated genes necessary for 4-aminoarabinose lipid A modification and polymyxin resistance.
Gunn JS, Lim KB, Krueger J, Kim K, Guo L, Hackett M, Miller SI.
Mol Microbiol. 1998 Mar;27(6):1171-82.
PMID: 9570402
The Salmonella typhi melittin resistance gene pqaB affects intracellular growth in PMA-differentiated U937 cells, polymyxin B resistance and lipopolysaccharide.
Baker SJ, Gunn JS, Morona R.
Microbiology. 1999 Feb;145 ( Pt 2):367-78.
PMID: 10075419
Proteomic analysis of outer membrane vesicles derived from Pseudomonas aeruginosa.
Choi DS, Kim DK, Choi SJ, Lee J, Choi JP, Rho S, Park SH, Kim YK, Hwang D, Gho YS.
Proteomics. 2011 Aug;11(16):3424-9.
PMID: 21751344