Please note that we will be retiring this old site on Tuesday, August 25th, 2015.
At that point, the URL for www.pseudomonas.com will bring you to our new site currently hosted at beta.pseudomonas.com. We encourage you to visit the new site now and see a more recent set of updated gene annotations and MANY more Pseudomonas strains.
Pseudomonas Genome Database - Annotation for PSPA7_0001
               gene PSPA7_0001                
Add this annotation to your clipboard
Key to gene image


View in GBrowse: (?)
46 putative orthologs Acknowledgements for this annotation
Feature Overview
Strain Pseudomonas aeruginosa PA7 (Tax ID: 381754) Replicon Pseudomonas aeruginosa PA7 chromosome, complete genome.
(6369 genes, 6588339 bp) [ RefSeq ]
Feature type gene  Genomic location 488 - 2026 (+ strand)
Name dnaA  (View this annotation at our new website) Alternate Names
Locus tag PSPA7_0001 Tranposon Mutant Available? No mutants described yet.
Product Information
Feature type CDS
Product Name chromosomal replication initiation protein
Product Name Confidence
Alternate Names
Charge at pH 7 (Predicted):6.33
Kyte-Doolittle Hydropathy Score (Predicted):-0.259
Molecular Weight (Predicted):57.5 kDa
Isoelectric Point (Predicted):8.88
Subcellular localization
CompartmentTypeConfidence LevelExplanation of Localization Confidence
Cytoplasmic Primary Class 3: Subcellular localization computationally predicted by PSORTb V3.0.
Orthologs/Comparative Genomics
Pseudomonas Ortholog Group Explanation of Orthologous Groups
Number of Orthologs in Pseudomonas species 46 putative orthologs
OrtholugeDB (New!) Explanation of Orthologous Groups
Alternate Annotations and Cross-References
RefSeq YP_001345397.1
GI 152989598
Precomputed BLAST results NCBI BLINK
Entrez 5359197
KEGG PSPA7_0001
GBrowse Click GBrowse for a GBrowse View of this and other annotations.
Gene Ontology (GO) - Participate in the 2014 Gene Ontology Annotation initiative and get your name on a consortium publication!
GO Accession GO Term Evidence
Code
Reviewed
by curator?
Reference
Molecular Function
GO:0003677 DNA binding ISS Yes
GO:0003688 DNA replication origin binding ISS Yes
GO:0043565 sequence-specific DNA binding ISS Yes
Biological Process
GO:0006260 DNA replication ISS Yes
Cellular Component
Function Classification
PseudoCAP Function Class DNA replication, recombination, modification and repair
Homology
BLINK Precomputed BLAST results at BLINK
Structure Features
CDD predictions Explanation of CDD predictions
CDD Accession External Accession Database Short Name Description Start Stop E-value Release Number
232941 TIGR00362 TIGRFAM DnaA chromosomal replication initiator protein DnaA 161 479 1e-166 3.10
223666 COG0593 COG DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] 171 508 8e-141 3.10
234667 PRK00149 PRK dnaA chromosomal replication initiation protein; Reviewed 171 510 0.0 3.10
144046 pfam00308 Pfam Bac_DnaA Bacterial dnaA protein 177 395 2e-104 3.10
197863 smart00760 SMART Bac_DnaA_C Bacterial dnaA protein helix-turn-helix domain 420 488 3e-29 3.10
119330 cd06571 CD Bac_DnaA_C C-terminal domain of bacterial DnaA proteins 421 510 7e-33 3.10
 
Comments
Comments Annotation was generated automatically without manual curation
binds to the dnaA-box as an ATP-bound complex at the origin of replication during the initiation of chromosomal replication; can also affect transcription of multiple genes including itself.
DNA Sequence
Upstream 500 BP Region TTAAAGAGACCGGCGATTCTAGTGAAATCGAACGGGCAGGTCAATTTCCAACCAGCGACCACGTAATAGATAGATACAGGGAAGTCATTTTTCTTTTAAA
GGATAGAAGCGGTTATTGCTCTTGGTTGGACCGGTTTCTGTGTATAACTCATTGAAAGCCATTAGGGGCGGGCATTTCCCATGGGCAAAAGGTTGTCGAG
AAACGGTGGCGAGGCTGTTTCGATCCTGCGCGAAGCCTGGGGATGGATGTCCTGGTTATCCACAGGGCTTTTTTCCACATGCCGATCACCAGGGATGTAC
CCCCAGCGGCACAAGGGTTATCCACACAGTTCAGGATGACCGTCCGTCGGTCGGCCTGCTTTTATTAAGGTCTTGATTTGCTTGGGTGCTCGGCGCATCG
GCATGTGGATAAGTCCGGCCCATACGGCTACAATAGGCGCTTCTTTCGTTGTGCCGCCTTTCCAATCTTTGGGGGATATCCGTGTCC


BLAST search against this genome or other genomes in database
Need more than 500 BP? Try our sequence retrieval tool or view intergenic regions in GBrowse.

DNA Sequence GTGGAACTCTGGCAGCAGTGCGTGGATCTTCTCCGCGATGAGCTGCCGTCCCAACAATTCAACACCTGGATCCGTCCCTTGCAGGTCGAAGCCGAAGGCG
ACGAATTGCGTGTGTATGCACCCAACCGTTTCGTCCTCGATTGGGTGAACGAGAAGTACCTCGGTCGCCTCCTGGAACTGCTCGGTGAACGCGGCGAGGG
GCAATTGCCCGCGCTTTCCTTATTAATAGGCAGCAAGCGCAGCCGCACCCCGCGTGCCGCCATCGTGCCATCGCAATCCCACGTGGCGCCCCCGCCTCCG
GTCGCACCGCCGCCTGCGCCGGTACAGCCGGTGTCTGCCGCACCGGTCGTGGTTCCTCGCGAAGAGCTGCCGCCTGTGGCGGCGGTTTCCAGCGTCACGG
CCGACTCCTACGAGGCGGAAGAACCGAGCATCGATCCGCTGGCCGTAGCCATGCCGGCTGGCGCCGCGCCGGCAATACGCACCGAGCGCAACGTCCAGGT
CGAAGGCGCGCTGAAGCACACCAGCTACCTGAACCGCACCTTCACCTTCGAGAACTTCGTCGAGGGCAAGTCCAACCAACTGGCCCGTGCCGCGGCCTGG
CAGGTGGCGGACAACCTCAAGCATGGCTACAACCCGCTGTTCCTCTATGGTGGGGTCGGCCTGGGCAAGACCCACCTGATGCATGCTGTAGGTAACCATC
TGCTGAAGAAGAATCCGAACGCCAAGGTCGTCTACCTGCATTCGGAGCGCTTCGTCGCGGACATGGTCAAGGCCCTGCAGCTCAACGCCATCAACGAATT
CAAGCGCTTCTACCGCTCGGTGGACGCGCTGCTGATCGACGATATCCAGTTCTTCGCCCGTAAGGAGCGCTCCCAGGAAGAGTTCTTCCACACCTTCAAC
GCCCTTCTCGAAGGCGGCCAGCAGGTGATCCTCACCAGCGACCGCTATCCGAAGGAAATCGAAGGCTTGGAAGAGCGGCTGAAATCCCGCTTCGGCTGGG
GCCTGACGGTGGCCGTCGAGCCGCCGGAACTGGAAACCCGTGTCGCGATCCTGATGAAGAAGGCCGAGCAGGCCAAGATCGAACTGCCGCACGATGCGGC
GTTCTTCATCGCCCAGCGCATCCGTTCCAACGTGCGCGAACTGGAAGGCGCGCTGAAGCGGGTGATCGCCCACTCGCACTTCATGGGTCGGCCGATCACC
ATCGAGCTGATCCGCGAGTCGCTGAAGGACCTGCTGGCCCTGCAGGACAAGCTGGTCAGCATCGACAACATCCAGCGCACCGTCGCCGAGTACTACAAGA
TCAAGATCTCCGATCTGTTGTCCAAGCGGCGTTCGCGTTCGGTGGCGCGTCCGCGCCAGGTGGCCATGGCGCTCTCCAAGGAGCTGACCAACCACAGCCT
GCCGGAGATCGGCGTAGCCTTCGGCGGTCGGGATCACACCACCGTGTTGCACGCCTGTCGTAAGATCGCTCAACTTAGGGAATCCGACGCGGATATCCGC
GAGGACTACAAGAACCTGCTGCGTACCCTGACTACCTGA


BLAST search against this genome or other genomes in database

Downstream 500 BP region CGCAGCCCACGAGGCAAGGGACTAGACCATGCATTTCACCATTCAACGCGAAGCCCTGTTGAAACCGCTGCAACTGGTCGCCGGCGTCGTGGAACGCCGC
CAGACATTGCCGGTTCTCTCCAACGTCCTGCTGGTGGTCGAAGGCCAGCAGCTGTCGCTGACCGGTACCGACCTCGAGGTCGAGCTGGTCGGTCGCGTGG
TACTGGAGGATGCCGCCGAGCCCGGCGAGATCACCGTACCGGCGCGCAAGCTGATGGACATCTGCAAGAGCCTGCCCAGCGATGTGCTGATCGACATCCG
TGTCGAAGAGCAGAAGCTCCTGGTGAAGGCCGGCCGCAGCCGTTTTACCCTCTCCACCCTGCCGGCCAACGACTTCCCCACCGTCGAGGAAGGCCCCGGT
TCGCTGAACTTCAGCATCGCCCAGAGCAAGCTGCGTCGCCTGATCGATCGCACCAGCTTCGCCATGGCGCAGCAGGATGTGCGCTACTACCTCAACGGCA
T


Protein Sequence
Protein Sequence MELWQQCVDLLRDELPSQQFNTWIRPLQVEAEGDELRVYAPNRFVLDWVNEKYLGRLLELLGERGEGQLPALSLLIGSKRSRTPRAAIVPSQSHVAPPPP
VAPPPAPVQPVSAAPVVVPREELPPVAAVSSVTADSYEAEEPSIDPLAVAMPAGAAPAIRTERNVQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAW
QVADNLKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFN
ALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKAEQAKIELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRPIT
IELIRESLKDLLALQDKLVSIDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAQLRESDADIR
EDYKNLLRTLTT


BLAST search against this genome or other genomes in database
Precomputed BLAST results at BLINK
Operons/Regulons
1) dnaA-dnaN-recF-gyrB ( View in GBrowse  )
Genomic Location: From 488 to 6694 bp on + strand
Genes:
PSPA7_0001 (dnaA) PSPA7_0002 (dnaN) PSPA7_0003 (recF) PSPA7_0004 (gyrB)
Estimated Length: 6206 bp (From 488 to 6694 bp)
Evidence:
Class 3: Computationally-predicted.
 [PubMed:18988623]
Cross Reference: DOOR (No external cross-reference is available).