Please note that we will be retiring this old site on Tuesday, August 25th, 2015.
At that point, the URL for www.pseudomonas.com will bring you to our new site currently hosted at beta.pseudomonas.com. We encourage you to visit the new site now and see a more recent set of updated gene annotations and MANY more Pseudomonas strains.
Pseudomonas Genome Database - Annotation for Pmen_0001
               gene Pmen_0001                
Add this annotation to your clipboard
Key to gene image


View in GBrowse: (?)
46 putative orthologs Acknowledgements for this annotation
Feature Overview
Strain Pseudomonas mendocina ymp (Tax ID: 399739) Replicon Pseudomonas mendocina ymp chromosome, complete genome.
(4703 genes, 5072807 bp) [ RefSeq ]
Feature type gene  Genomic location 82 - 1566 (+ strand)
Name dnaA  (View this annotation at our new website) Alternate Names
Locus tag Pmen_0001 Tranposon Mutant Available? No mutants described yet.
Product Information
Feature type CDS
Product Name chromosomal replication initiation protein
Product Name Confidence
Alternate Names
Charge at pH 7 (Predicted):9.09
Kyte-Doolittle Hydropathy Score (Predicted):-0.288
Molecular Weight (Predicted):55.3 kDa
Isoelectric Point (Predicted):9.47
Subcellular localization
CompartmentTypeConfidence LevelExplanation of Localization Confidence
Cytoplasmic Primary Class 3: Subcellular localization computationally predicted by PSORTb V3.0.
Orthologs/Comparative Genomics
Pseudomonas Ortholog Group Explanation of Orthologous Groups
Number of Orthologs in Pseudomonas species 46 putative orthologs
OrtholugeDB (New!) Explanation of Orthologous Groups
Alternate Annotations and Cross-References
Entrez 5105694
RefSeq YP_001185508.1
GI 146305043
Precomputed BLAST results NCBI BLINK
KEGG Pmen_0001
GBrowse Click GBrowse for a GBrowse View of this and other annotations.
Gene Ontology (GO) - Participate in the 2014 Gene Ontology Annotation initiative and get your name on a consortium publication!
Function Classification
PseudoCAP Function Class
Homology
BLINK Precomputed BLAST results at BLINK
Structure Features
CDD predictions Explanation of CDD predictions
CDD Accession External Accession Database Short Name Description Start Stop E-value Release Number
232941 TIGR00362 TIGRFAM DnaA chromosomal replication initiator protein DnaA 5 461 2e-177 3.10
223666 COG0593 COG DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] 153 490 7e-142 3.10
234667 PRK00149 PRK dnaA chromosomal replication initiation protein; Reviewed 153 492 0.0 3.10
144046 pfam00308 Pfam Bac_DnaA Bacterial dnaA protein 159 377 3e-105 3.10
197863 smart00760 SMART Bac_DnaA_C Bacterial dnaA protein helix-turn-helix domain 402 470 3e-29 3.10
119330 cd06571 CD Bac_DnaA_C C-terminal domain of bacterial DnaA proteins 403 492 3e-33 3.10
 
Comments
Comments binds to the dnaA-box as an ATP-bound complex at the origin of replication during the initiation of chromosomal replication; can also affect transcription of multiple genes including itself.
TIGRFAM: chromosomal replication initiator protein DnaA PFAM: Chromosomal replication initiator, DnaA C-terminal domain
DNA Sequence
Upstream 500 BP Region GCGTGTGGATAACTCGGGCGTTGCTCGCTACAATAGCCGCTGTTTTTGCATCGCCGCCTGGATAGGGGATAGTCAGTGTCA

BLAST search against this genome or other genomes in database
Need more than 500 BP? Try our sequence retrieval tool or view intergenic regions in GBrowse.

DNA Sequence GTGGAACTATGGCAGCAGTGCGTCGAGCTTCTGCGCGACGAATTGCCGGCTCAGCAATTCAACACCTGGATCCGTCCTCTGCAGGTCGAAGCCGAAGGCG
ACGAGCTGCGCGTCTACGCGCCCAATCGTTTTGTGCTCGACTGGGTCAACGAAAAGTACCTGAGCCGCCTGCTCGAGTTGCTGGGTGAGCGCGCCGGGGG
CCTGGTGCCGGCGCTTTCCTTATTGATAGGCAGCAAGCGAGCGGCTACCGCTCGGGTCGCACCTACCGCGCCCTTGCCTGCCGCAGCGCGTGCGGCGCAG
GTTCAGGCAGCCGCCACGGCGAGCAAGCCGGTACCACCGCCCGCCCAGGAAGAACCCTCGCGCGCCAGCTTCGACTCCATGGCCGGCGCCGCGCCGCAGC
CACCAACCCCAGCCGTCGCACCGCGTGCCGAGCGCACCGTGCAGGTCGAGGGCGGGCTCAAGCACACCAGTTACCTCAACCGCACCTTCACCTTCGACAA
TTTCGTCGAGGGCAAGTCCAACCAGTTGGCGCGCGCCGCTGCCTGGCAGGTTGCGGACAATCCCAAGCACGGTTACAACCCGCTGTTCCTTTATGGCGGC
GTGGGCCTGGGCAAGACGCACCTGATGCACGCCGTGGGTAACCACCTGCTGGCGAAGAACCCCAACGCCAAGGTGGTGTACCTGCATTCCGAGCGCTTCG
TCGCCGACATGGTCAAGGCGCTGCAGCTCAACGCCATCAACGAATTCAAACGCTTCTACCGTTCGGTGGACGCGCTGCTGATCGACGATATCCAGTTCTT
CGCCAAGAAAGAGCGTTCCCAGGAAGAGTTCTTCCACACCTTCAACGCCCTGCTCGAAGGCGGCCAACAGGTGATCCTCACCAGCGACCGCTACCCGAAG
GAGATCGAAGGCCTGGAAGAGCGCTTGAAGTCTCGTTTCGGCTGGGGCCTGACCGTGGCCGTCGAGCCGCCGGAGCTGGAAACCCGCGTGGCGATCCTGA
TGAAGAAGGCCGACCAGGCCAAGGTCGAGCTGCCGCACGATGCCGCATTCTTCATTGCCCAGCGCATTCGCTCCAACGTGCGTGAGCTGGAAGGTGCGCT
GAAACGGGTGATCGCCCACTCGCACTTCATGGGCCGCGATATCACCATCGAGCTGATCCGCGAATCCCTCAAGGATCTGCTGGCCCTGCAGGACAAGCTG
GTCAGCATCGACAATATCCAGCGCACCACGGCCGAGTACTACAAGATCAAGATTTCCGATCTGCTGTCCAAGCGTCGCTCACGCTCCATCGCCCGGCCAC
GCCAGGTGGCCATGGCATTGTCGAAGGAGCTGACCAACCACAGCCTGCCGGAAATCGGTGTGGCCTTCGGCGGTCGCGATCACACCACGGTATTGCACGC
ATGCCGTAAGATTGCTGAACTTAGGGAATCCGACGCGGACATCCGCGAGGACTACAAGAACCTGCTGCGCACCCTCACTACCTGA


BLAST search against this genome or other genomes in database

Downstream 500 BP region TTCAATGCAGCTCCACGAGGCAAGGGACTAGACCATGCATTTCACCATTCAACGCGAAGCCCTGTTGAAACCCCTGCAACTGGTCGCCGGTGTCGTGGAA
CGACGCCAGACGCTGCCGGTGTTGTCCAACGTCCTGCTGGTGGTCGAAGGCCAGCAGCTCTCGCTTACCGGTACCGACCTGGAGGTCGAACTGGTTGGCC
GCGTCACCCTCGAAGACGCTGCCGAGCCGGGCGAAATCACCGTACCGGCGCGCAAGCTGATGGATATCTGCAAGAGCCTGCCGAGCGATGCGCTGATCGA
TATCCGCGTCGATGACCAGAAGCTGCTGGTCAAGGCCGGGCGCAGTCGTTTCACCCTGTCGACGCTGCCGGCCAATGACTTCCCCACCGTCGAGGAAGGT
CCGGGTTCGCTGACCTTCAACCTGCCGCAGGCCAAGCTGCGTCGCCTGATCGAACGCACCAGCTTCGCCATGGCCCAGCAGGACGTGCGCTACTACCTCA
A


Protein Sequence
Protein Sequence MELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPNRFVLDWVNEKYLSRLLELLGERAGGLVPALSLLIGSKRAATARVAPTAPLPAAARAAQ
VQAAATASKPVPPPAQEEPSRASFDSMAGAAPQPPTPAVAPRAERTVQVEGGLKHTSYLNRTFTFDNFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGG
VGLGKTHLMHAVGNHLLAKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDIQFFAKKERSQEEFFHTFNALLEGGQQVILTSDRYPK
EIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRDITIELIRESLKDLLALQDKL
VSIDNIQRTTAEYYKIKISDLLSKRRSRSIARPRQVAMALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAELRESDADIREDYKNLLRTLTT


BLAST search against this genome or other genomes in database
Precomputed BLAST results at BLINK
Operons/Regulons
1) dnaA-Pmen_0002-recF-gyrB ( View in GBrowse  )
Genomic Location: From 82 to 6240 bp on + strand
Genes:
Pmen_0001 (dnaA) Pmen_0002 (Pmen_0002) Pmen_0003 (recF) Pmen_0004 (gyrB)
Estimated Length: 6158 bp (From 82 to 6240 bp)
Evidence:
Class 3: Computationally-predicted.
 [PubMed:18988623]
Cross Reference: DOOR (No external cross-reference is available).